(data stored in ACNUC8465 zone)

EMBL: FN543502.PE57

FN543502.PE57        Location/Qualifiers
FT   CDS_pept        65839..65973
FT                   /transl_table=11
FT                   /locus_tag="ROD_00541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00541"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86835"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGF2"
FT                   /protein_id="CBG86835.1"
FT                   /translation="MPGVHYQVVDSPAERKIFVLLLFSSVDERMLFTYSGDNFFVSGK"
     atgccgggag tccactatca agtcgtggac tcgccagcag aacgaaaaat tttcgtgctc        60
     ttactctttt cgtcagtcga cgaaagaatg ctctttacgt atagtggcga caattttttt       120
     gtctccggga aataa                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page