(data stored in ACNUC8465 zone)

EMBL: FN543502.PHOE

FN543502.PHOE        Location/Qualifiers
FT   CDS_pept        complement(359682..360734)
FT                   /transl_table=11
FT                   /gene="phoE"
FT                   /locus_tag="ROD_03361"
FT                   /product="outer membrane pore protein E"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_03361"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87118"
FT                   /db_xref="GOA:D2TJZ0"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:D2TJZ0"
FT                   /protein_id="CBG87118.1"
FT                   /translation="MKKSTLALVVMGMAASASVQAAEVYNKNGNKLDVYGKVKAMHYFS
FT                   DDNAKDGDQTYVRFGFKGETQINDQLTGYGRWEAEFAGNKPESESGQKTRLAFAGLKFG
FT                   EYGSFDYGRNLGALYDVAAWTDMFPEFGGDGMAQTDNFMTKRASGLATYRNTDFFGLVD
FT                   GLNLTLQYQGKNENRDVKKQNGDGFGTSLSYDFGGSDFAIIGAYANFDRTNEQNLQARG
FT                   QGQNAEGWATGLKYDANNVYLATIYSETRNMAPISGGFANKAQNFEAVAQYQFDFGLRP
FT                   SVGYVQSKGKDIEGIGDEDIVKYIDVGMTYYFNKNMSAFVDYKINQIDDDNQLGVSSDD
FT                   IVALGMTYQF"
     atgaaaaaga gcactctggc attagtggtg atgggaatgg ctgcatcggc atccgtgcag        60
     gcagcagaag tgtataacaa gaacggtaat aaactggatg tgtatggcaa agtgaaggcg       120
     atgcactatt tcagcgatga caacgccaaa gacggcgacc agacctatgt ccgtttcggc       180
     ttcaaaggcg aaacgcagat taacgaccag ttgaccggct acggtcgctg ggaagccgaa       240
     ttcgcgggca ataaaccaga aagcgaaagc ggccagaaaa cgcgtctggc gttcgccggg       300
     cttaagtttg gcgagtatgg ctcatttgat tatggccgca acctcggcgc gctgtatgac       360
     gtcgccgcat ggaccgatat gttcccggag ttcggcggcg acggcatggc gcagaccgac       420
     aactttatga ccaagcgcgc cagcggtctg gcgacgtacc gtaacaccga cttcttcggc       480
     ctggttgatg gtcttaatct gacgctgcaa tatcagggta aaaacgaaaa ccgcgacgtg       540
     aagaaacaga acggcgatgg cttcggcacc tccctgagct acgacttcgg cggcagcgac       600
     ttcgccatta tcggcgccta cgccaatttc gatcgcacca acgagcagaa cctgcaggcg       660
     cggggccagg ggcaaaatgc ggaaggctgg gcgaccggtc tgaaatatga cgccaacaat       720
     gtgtatctgg cgactatcta ttcagaaacc cgcaatatgg cgccgatttc cggcggattt       780
     gccaataaag cgcaaaactt cgaggccgtc gcgcaatatc agttcgactt tggtctgcgt       840
     ccgtcggtgg gctatgtgca gtcgaaaggc aaagatattg aagggatcgg tgatgaggat       900
     atcgtgaaat atatcgatgt cggcatgacg tactatttca acaaaaacat gtccgcattc       960
     gtggattata aaatcaacca gattgatgac gataatcagc tgggcgtcag cagcgacgat      1020
     atcgtggcgc tgggtatgac ctatcagttc tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page