(data stored in ACNUC8465 zone)

EMBL: FN543502.PHOR

FN543502.PHOR        Location/Qualifiers
FT   CDS_pept        495321..496628
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="ROD_04441"
FT                   /product="phosphate regulon two-component system, sensor
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04441"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87224"
FT                   /db_xref="GOA:D2TKY3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKY3"
FT                   /protein_id="CBG87224.1"
FT                   /translation="MLERLSWKRLVLELILCCIPAFILSAFFGYLPWFLLASVTGLLIW
FT                   HFWNLLRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGA
FT                   ESLPDAVVLTTEEGGIFWCNGLAQQLLGLRWPDDNGQNILNLLRYPEFTQYLKTRDFSR
FT                   PLNLVLNTGRHLEIRVMPYTDKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVL
FT                   QGYLEMMHEQPLEGSTREKALLTMREQTFRMEGLVKQLLTLSKIEASPVLLLNEQVDVP
FT                   MMLHMVEREAQTLSQQKHTFSFDIDNQLKVLGNEEQLRSAISNLVYNAVNHTPEGTHIT
FT                   VCWRAVPHGAEFSIEDNGPGIAAEHLPRLTERFYRVDKARSRQTGGSGLGLAIVKHALN
FT                   HHESRLTIDSEPGKGTRFSFVLPERLIARKPPDRRL"
     gtgctggaaa gattgtcatg gaagaggctg gtgctggaac tgatcctgtg ttgtatcccg        60
     gcctttatcc tcagcgcttt tttcggttac ctgccgtggt ttttgctggc atcggtaacg       120
     ggactgctta tctggcattt ctggaattta ttacgcctgt cctggtggct gtgggtcgac       180
     agaagcatga cgccgccgcc gggacgcgga agctgggagc cgctgttgta cgggttgcat       240
     cagatgcagc tgcgcaacaa aaagcgtcgg cgcgagctgg gcaatttgat caaacgcttt       300
     cgcagcggag ccgaatcgct gccggacgcg gtggtgctga ccaccgaaga gggcggcatt       360
     ttctggtgta acggcctggc gcaacagctg ctgggcttac gctggccgga cgataacggg       420
     cagaacatcc tcaacctgct gcgctatccg gagtttaccc agtatctgaa aacccgcgat       480
     ttcagccgac cgttaaatct ggtgctcaat accgggcggc atctggagat tcgcgtgatg       540
     ccctacaccg acaagcagct gctgatggtt gcccgcgacg tgacccagat gcaccagctt       600
     gagggggcaa gacgtaactt cttcgccaac gtcagccacg agctgcgcac tccgcttacc       660
     gtgttgcagg gctatcttga aatgatgcac gagcagccgc tggaagggag cacgcgtgag       720
     aaagcgctat tgacgatgcg ggagcagact ttccgtatgg aggggctggt gaagcagttg       780
     ctgaccctgt cgaagataga agcctcgccg gtattgctgc ttaatgaaca ggtcgatgtg       840
     ccgatgatgc tgcacatggt ggagcgcgaa gcgcagacgc tcagccagca aaagcacacc       900
     ttcagctttg acatcgataa tcagctgaaa gtcctgggta acgaagagca gttgcgtagc       960
     gccatttcaa acctggtgta taacgccgtc aaccatacgc ctgaaggcac ccatatcacc      1020
     gtgtgctggc gcgcggtgcc gcacggcgcg gaattcagca ttgaggataa cgggccgggg      1080
     attgcggcgg agcatcttcc gcggctgacc gaacgttttt atcgcgtcga taaagcgcgc      1140
     tcaagacaaa ccggcggcag cgggctgggg ctggcaatcg tcaaacatgc gctgaatcat      1200
     catgaaagtc gcttaaccat cgacagcgaa ccggggaaag gcacgcgctt cagctttgtg      1260
     ctgccggaac gtttaattgc cagaaaacca cctgacaggc gattgtaa                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page