(data stored in ACNUC8465 zone)

EMBL: FN543502.PPDD

FN543502.PPDD        Location/Qualifiers
FT   CDS_pept        complement(132927..133379)
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="ROD_01121"
FT                   /product="prepilin peptidase dependent protein D precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01121"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86892"
FT                   /db_xref="GOA:D2TGP3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGP3"
FT                   /protein_id="CBG86892.1"
FT                   /translation="MDKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDILQT
FT                   FVPYRTAVELCALEHGGVATCDAGSNGIPAPTTTRYVSAMSVAKGVVSMSGQESLNGLS
FT                   VVMTPVWDNANGITGWTRSCAIQNDGALQQACEDVFRFDANAGGSE"
     atggataaac aacgtggatt cacccttatt gaactgatgg tggtgatcgg cattatcgcg        60
     attctcagcg ccatcggcat tccggcgtac cagaactatc tgcgcaaggc tgcgctcacg       120
     gacatactgc aaaccttcgt cccctaccgc accgccgttg aactttgcgc gctggaacat       180
     ggcggcgtcg cgacctgcga tgcaggaagt aacggcattc ccgccccgac caccacccgc       240
     tacgtctcgg ccatgagcgt ggcgaaggga gtggtttcaa tgagcggcca ggaaagtttg       300
     aacgggctca gcgtggtcat gacgccggtc tgggataacg ctaacggcat aacgggctgg       360
     acgcgcagct gcgcgattca gaatgacggc gcgttgcagc aggcctgtga agacgttttt       420
     cgctttgatg ccaacgcagg aggttcagaa tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page