(data stored in ACNUC8465 zone)

EMBL: FN543502.RDGC

FN543502.RDGC        Location/Qualifiers
FT   CDS_pept        complement(485339..486250)
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="ROD_04371"
FT                   /product="recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04371"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87217"
FT                   /db_xref="GOA:D2TKX6"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKX6"
FT                   /protein_id="CBG87217.1"
FT                   /translation="MLWFKNLMVYRLSRDISLRAEEMEKQLASMTFTPCGSQDMAKMGW
FT                   VPPMGSHSDALTHAHNGQILICARKEEKILPSPVIKQALEAKIAKLEAEQARKLKKTEK
FT                   DSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGSLPV
FT                   VPLALENPIELTLTEWVRSGSVAQGFQLLDEAELKAMLEDGGVIRAKKQDLVSDEIAVH
FT                   IEAGKVVTKLALDWQQRIQFLVCDDGSIKRLKFSDELRDQNEDIDREDFAQRFDADFIL
FT                   MTGELAALIQNLVEGLGGEAQR"
     atgctgtggt tcaaaaattt aatggtttac cgtcttagcc gcgatatttc gctgcgtgcc        60
     gaggagatgg aaaaacagtt agcctcaatg acctttaccc catgcggcag ccaggatatg       120
     gcgaaaatgg gctgggtgcc gccgatggga tcgcacagcg atgcgttgac ccatgctcac       180
     aacggccaga tcctgatttg cgcgcgcaaa gaggagaaga tcctgccttc gccggtaatc       240
     aaacaggcgc tggaggcgaa aatcgccaaa ctggaagccg aacaggcgcg caagctgaag       300
     aaaaccgaga aagattcgct gaaagatgaa gtgctgcatt cgctgctgcc gcgcgccttc       360
     agccgcttca gccagacgat gatgtggatc gacacggtaa acgggctgat catggtggac       420
     tgcgccagcg cgaaaaaagc ggaagatacg ctggcgctgc tacgtaaaag cctcggctcg       480
     ctgccggtag tgccgctggc gctggaaaat ccaatcgaac tgacgctcac cgagtgggtg       540
     cgttccggta gcgtcgcgca gggcttccag ctgctggatg aagccgaact gaaggcgatg       600
     ctggaagacg gcggcgttat ccgcgccaaa aagcaggacc tggtcagcga cgaaatcgcc       660
     gtccatattg aagccggtaa agtggtgacc aaactggcgc tcgactggca acagcgtatt       720
     cagtttctgg tttgcgatga tggttcgatt aagcgcctga aattcagcga tgagctgcgc       780
     gatcagaacg aggatatcga ccgggaagat ttcgcccagc gctttgacgc cgactttatt       840
     ctgatgaccg gggaactggc ggcgctgatc cagaatctgg tggaaggtct tggcggagaa       900
     gcgcagcgct aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page