(data stored in ACNUC8465 zone)

EMBL: FN543502.SECA

FN543502.SECA        Location/Qualifiers
FT   CDS_pept        124135..126840
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="ROD_01041"
FT                   /product="preprotein translocase SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_01041"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86884"
FT                   /db_xref="GOA:D2TGN5"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGN5"
FT                   /protein_id="CBG86884.1"
FT                   /translation="MLIKMLTKVFGSRNDRTLRRMRKVVGVINAMEPEMEKLSDEELKA
FT                   KTAEFRARLEQGASVESLIPEAFAVVREASKRVFGMRHFDVQLLGGMVLNDRCIAEMRT
FT                   GEGKTLTATLPAYLNALSGKGVHVVTVNDYLAQRDAENNRPLFEFLGMTVGINLPGMPA
FT                   PAKREAYAADITYGTNNEYGFDYLRDNMAFSPEERVQRKLHYALVDEVDSILIDEARTP
FT                   LIISGPAEDSSEMYKKVNKIIPHLVRQEKEDSDTFQGEGHFSVDEKARQVNLTERGLVL
FT                   IEELLVKEGIMDEGESLYSPGNIMLMHHVTAALRAHVLFTRDVDYIVKDGEVIIVDEHT
FT                   GRTMQGRRWSDGLHQAVEAKEGVDIQNENQTLASITFQNYFRLYEKLAGMTGTADTEAF
FT                   EFSSIYKLDTVVVPTNRPMIRKDMPDLVYMTEAEKIQAIIEDIKERTANGQPVLVGTIS
FT                   IEKSEVVSNELTKAGIKHNVLNAKFHANEAAIVAQAGYPSAVTIATNMAGRGTDIMLGG
FT                   SWQAEIAALENPTPEQIAQIKADWQVRHDAVLAAGGLHIIGTERHESRRIDNQLRGRSG
FT                   RQGDPGSSRFYLSMEDALMRIFASDRVSGMMRKLGMKPGEAIEHPWVTKAIANAQRKVE
FT                   SRNFDIRKQLLEYDDVANDQRRAIYTQRNELLDVSDVSETINSIREDVFKATIDAYIPP
FT                   QSLEEMWDIPGLQERLKNDFDLDMPIAEWLDKEPELHEETLRERILSQAIEVYQRKEEV
FT                   VGAEMMRHFEKGVMLQTLDSLWKEHLAAMDYLRQGIHLRGYAQKDPKQEYKRESFAMFA
FT                   AMLESLKYEVISTLSKVQVRMPEEVEAMELQRREEAERLAQMQQLSHQDDHAAAAADLA
FT                   AQTGERKVGRNDPCPCGSGKKYKQCHGRLS"
     atgctaatca aaatgttaac aaaagtattc ggtagtcgta acgatcgtac gttgcgtcgt        60
     atgcgtaaag tagtcggcgt gatcaacgcc atggaaccgg agatggaaaa actctccgat       120
     gaagaactga aggcgaaaac cgccgaattc cgcgcgcgtc tcgagcaggg cgccagcgtg       180
     gaaagcctga ttccggaagc cttcgcggtt gtgcgcgaag ccagtaagcg cgtgttcggc       240
     atgcgtcact tcgacgttca gctgctcggc ggtatggtgc taaacgatcg ctgcatcgcg       300
     gaaatgcgta ccggtgaagg taaaaccctg accgcaacgc tgccggccta cctgaatgcg       360
     ctgagcggaa agggcgtaca cgtggttacc gtcaacgact atctggccca gcgtgacgcc       420
     gagaacaacc gtccgctgtt cgaattcctc ggcatgaccg tcggtattaa cctgccgggt       480
     atgcctgcgc cagccaagcg cgaagcctac gcagccgaca ttacctacgg caccaacaac       540
     gaatatggct ttgactacct gcgcgacaat atggcgttca gccctgaaga gcgcgtccag       600
     cgtaaactgc actatgcgct ggtggatgag gtcgactcca tcctgatcga tgaagcgcgt       660
     acgccgctta ttatttccgg cccggcggaa gacagctcgg aaatgtataa gaaggtgaac       720
     aaaatcattc cgcacctggt tcgccaggaa aaagaagact ccgacacctt ccagggggaa       780
     ggtcacttct cggtagatga gaaagcgcgc caggttaacc tgaccgaacg cggtctggtg       840
     ctgatcgaag agctgctggt gaaagaaggc attatggatg aaggcgagtc actgtactct       900
     ccgggcaata tcatgctgat gcaccatgtc accgcggcgc tgcgcgcgca cgtgctgttc       960
     acccgcgacg ttgattacat cgtgaaagac ggtgaagtca ttatcgttga tgagcatacc      1020
     ggtcgtacca tgcagggccg tcgctggtct gatggtctgc accaggcggt tgaagccaaa      1080
     gaaggcgtgg acatccagaa cgaaaaccag acgctggctt ccattacctt ccagaactat      1140
     ttccgtctgt acgaaaagct ggccggtatg accggtacgg cagacaccga ggcgtttgaa      1200
     ttcagctcta tctacaagct ggataccgtg gtggtgccga ctaaccgtcc gatgatccgt      1260
     aaagatatgc cggatctggt ctacatgacc gaagcggaaa aaattcaggc catcattgaa      1320
     gatatcaaag agcgtaccgc aaatggtcag ccggtgctgg tcggtacgat ctccattgag      1380
     aaatctgaag tcgtttctaa cgagctgact aaagcaggca tcaagcataa cgttctgaac      1440
     gccaagttcc acgccaacga agcggcgatt gtcgcgcagg cgggttatcc gtcggcggtg      1500
     actatcgcca ccaacatggc cggtcgcggt acggatatta tgctgggcgg tagctggcag      1560
     gcggaaatcg ccgcgctgga aaatccgacg ccggagcaga tcgcgcagat caaagcggac      1620
     tggcaggtgc gtcacgatgc ggtcctggct gcgggcggcc tgcacatcat tggtactgag      1680
     cgtcacgaat cacgtcgtat cgataaccag ctgcgcggcc gttcgggtcg tcagggggat      1740
     ccgggctcct cgcgtttcta cctgtcgatg gaagatgcgc tgatgcgtat ttttgcctct      1800
     gaccgcgtct ccggcatgat gcgtaaacta ggaatgaagc cgggcgaagc gattgaacac      1860
     ccgtgggtga ccaaagcgat tgccaacgcg cagcgcaaag tggaaagccg taacttcgat      1920
     attcgtaagc agctgctgga atacgatgac gtcgccaacg atcagcgtcg cgcgatctac      1980
     acccagcgta acgaactgct ggatgtgtct gacgtgagcg aaaccatcaa cagcattcgt      2040
     gaagatgtct ttaaagcgac catcgatgcc tatattccgc cgcagtctct ggaggagatg      2100
     tgggatatcc ctggtttgca ggagcgtctg aaaaatgact tcgatctgga tatgccgatc      2160
     gcggaatggc tggataaaga gccagaactg catgaagaga cgctgcgcga gcgtattctg      2220
     agccaggcga tcgaggtgta tcagcgcaaa gaagaggtgg ttggcgcgga gatgatgcgt      2280
     cacttcgaaa aaggcgtgat gttgcagact ctcgactccc tgtggaaaga gcacctggcg      2340
     gcgatggact atctgcgtca ggggatccac ctgcgtggct atgcgcagaa agatccgaag      2400
     caggagtaca agcgcgaatc tttcgccatg ttcgccgcga tgctggagtc gctgaagtat      2460
     gaagtgatca gcacgctaag caaagtgcag gtacgtatgc cggaagaggt tgaagcgatg      2520
     gaactgcaac gtcgtgaaga ggcggaacgt ctggcgcaga tgcagcagct tagccatcag      2580
     gacgaccatg ctgcggccgc tgctgacctg gcggcgcaaa ccggcgagcg caaagtcggg      2640
     cgcaacgatc cgtgcccttg cggttccggt aagaaataca aacagtgcca cggtcgtctg      2700
     agctga                                                                 2706
//

If you have problems or comments...

PBIL Back to PBIL home page