(data stored in ACNUC8465 zone)

EMBL: FN543502.THIL

FN543502.THIL        Location/Qualifiers
FT   CDS_pept        518837..519814
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="ROD_04661"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04661"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87245"
FT                   /db_xref="GOA:D2TL04"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D2TL04"
FT                   /protein_id="CBG87245.1"
FT                   /translation="MACGEFSLIARYFDRVRSSRRDVETGIGDDCALLNIPEKQTLAIS
FT                   TDTLVAGNHFMPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPEVDEAWLETFS
FT                   DSLFDLLNYYDMQLIGGDTTRGPLSMTLGIHGYVPVGRALKRAGAKPGDWIYVTGTPGD
FT                   SAAGLAILQNRLQVADDVDNAYLLQRHLRPTPRILQGQALRDLASAAIDLSDGLISDLG
FT                   HIVKASACGARIDVDALPYSQAMLRHVGAEQALRWALSGGEDYELCFTVPELNRGALDV
FT                   ALAHLGVPFTCIGQMSADVEGICFIRDGEPVTFDWKGYDHFAAL"
     atggcatgcg gcgagttctc cctgattgcc cgttattttg atcgtgtcag aagctctcgt        60
     cgcgatgtcg aaaccggtat tggcgatgat tgcgcactcc tgaatattcc tgaaaaacag       120
     accctggcga tcagtaccga tacgctggtg gcgggcaatc attttatgcc ggatatcgat       180
     ccggcggatc tggcgtataa ggcgctggcg gttaatttaa gcgatctggc ggcgatgggc       240
     gcagacccgg cgtggctgac gctggcgtta acgctgccgg aggtggatga agcgtggctg       300
     gaaaccttca gcgacagcct gttcgatcta ttaaattatt acgatatgca gctgattggc       360
     ggcgatacca cccgtgggcc gctctccatg acgctgggta tccacggcta tgtgccggtc       420
     gggcgtgcgc tgaaacgcgc tggcgcgaag ccgggcgact ggatttacgt taccggtacg       480
     ccgggcgaca gcgcggcggg actggcgatt ttacagaacc gtttgcaggt ggcggatgac       540
     gtggacaacg cgtatctgct gcaacggcat ctgcgcccga cgccgcgtat tttacagggg       600
     caggcgctgc gcgatctagc cagcgcggcc atcgatttgt ccgacgggct gatttccgat       660
     ctcgggcata tcgtcaaagc cagcgcctgc ggcgcgcgca ttgatgttga tgcgctgcct       720
     tattcgcagg cgatgttacg ccatgtcggg gcggagcagg ccctgcgctg ggcgctctcc       780
     ggcggcgaag attacgaatt atgctttacg gtgccggagc ttaaccgtgg ggcgctggac       840
     gtggcgcttg ctcatctcgg cgtccccttt acctgcattg gccagatgag cgcggatgtg       900
     gaagggattt gctttatccg tgacggcgag cctgtcacct tcgactggaa aggatatgac       960
     cattttgccg cgctctaa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page