(data stored in ACNUC8465 zone)

EMBL: FN543502.THIQ

FN543502.THIQ        Location/Qualifiers
FT   CDS_pept        complement(87773..88483)
FT                   /transl_table=11
FT                   /gene="thiQ"
FT                   /locus_tag="ROD_00731"
FT                   /product="thiamine ABC transport system, ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_00731"
FT                   /db_xref="EnsemblGenomes-Tr:CBG86853"
FT                   /db_xref="GOA:D2TGH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2TGH2"
FT                   /protein_id="CBG86853.1"
FT                   /translation="MLKLTDITWLYHHLPMRFTLAVERGEQVAILGPSGAGKSTLLNLI
FT                   AGFLTPARGTLFIAGADHTATPPSRRPVSMLFQENNLFSHLNVAQNIGLGLDPGLKLSA
FT                   AQRDKRQRIAQQMGIDGLMDRLPGELSGGQRQRVALARCLVREQPVLLLDEPFSALDPA
FT                   LRQEMLTLVSDICRNQQLTMLMVSHSVEDAARIARRSVVVADGRIAWQGETQELLSGRA
FT                   SASALLGIKGHTVL"
     atgttaaaac tgactgatat cacctggctt taccatcatc tgccgatgcg ctttacgctg        60
     gcggtggagc gcggagaaca ggtggcgatc ctgggaccga gcggcgccgg aaaaagcact       120
     ttgctgaatc tgattgccgg ttttcttacc cctgcccgcg gcacgctgtt tattgcaggc       180
     gcggatcata ccgccacgcc cccctcccgc cgcccggtgt cgatgctgtt tcaggaaaac       240
     aacctgttca gccatctgaa cgtcgcgcag aacatcggtc tgggactgga cccggggctg       300
     aaactgagcg ccgcgcagcg cgacaagcgc cagcgcattg cgcagcagat gggaatcgac       360
     ggtctgatgg atcgcctgcc cggcgagctt tccggcggtc agcggcagcg cgtcgcgctg       420
     gcgcgctgtc tggtgcgcga gcagccggtg ctgctgcttg acgagccgtt ttccgccctc       480
     gacccggccc tgcgccagga gatgctgacg ctggtcagcg atatctgccg caaccagcag       540
     ttaacgatgc tgatggtttc acacagcgtg gaagatgccg cccgcattgc gcgccgttcg       600
     gtggtggtgg ccgacgggcg aattgcctgg cagggagaaa cgcaggagtt attaagcggc       660
     agagccagcg cctcagcgct gctgggaata aaaggtcata cggttctgtg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page