(data stored in ACNUC8465 zone)

EMBL: FN543502.TSX

FN543502.TSX         Location/Qualifiers
FT   CDS_pept        complement(514360..515214)
FT                   /transl_table=11
FT                   /gene="tsx"
FT                   /locus_tag="ROD_04601"
FT                   /product="nucleoside-specific channel-forming protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04601"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87239"
FT                   /db_xref="GOA:D2TKZ8"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKZ8"
FT                   /protein_id="CBG87239.1"
FT                   /translation="MKKTLLAAGAVLALSSTFTVNAAENDKPQYLSDWWHQSVNVVGSY
FT                   HTRFGPTLRNDTYLEYEAFAKKDWFDFYGYVDAPRFFGGDSNSRGIWNHGSPLFMEIEP
FT                   RFSIDKLTNSDLSFGPFKEWYFANNYIYDMGRNSEGRQSTWYMGLGTDVDTGLPMSLSL
FT                   NVYAKYQWQNYGASNENEWDGYRFKVKYFVPITELWGGNLSYIGFTNFDWGSDLGDDQY
FT                   RTSNSIASSHILALNYDHWHYSVVARYFHNGGQWKDGDEPVWQAEPIKSNGFGWYLVVG
FT                   YNF"
     atgaaaaaaa cattacttgc agccggtgcc gtgctcgcgc tctcttcaac tttcaccgtg        60
     aacgccgcgg agaacgataa accgcagtat ctttccgact ggtggcacca gagcgtcaac       120
     gtggtgggtt cttaccatac ccgcttcgga cccactctgc gcaacgatac ctatcttgaa       180
     tacgaagctt tcgctaaaaa agactggttt gatttctatg gttacgttga tgccccgcgc       240
     tttttcggcg gcgacagcaa ctcacgcggg atctggaacc acggttctcc gctgtttatg       300
     gagatcgaac cgcgtttttc cattgataag ctgaccaata gcgatctgag cttcggtccg       360
     ttcaaagagt ggtatttcgc caataactat atctacgata tgggccgtaa cagcgaaggc       420
     cgccagagca cctggtatat gggtctgggc accgatgtcg ataccggtct gccgatgagc       480
     ctgtctctga acgtgtatgc gaaatatcag tggcagaact acggcgcgtc aaatgaaaac       540
     gaatgggacg gctaccgttt caaagtgaaa tactttgtgc cgattaccga gctgtggggc       600
     ggtaatctga gctacattgg cttcaccaac ttcgactggg gttccgatct cggcgacgat       660
     cagtaccgca ccagcaactc tatcgcatcc agccatattc tggcgctgaa ctacgatcac       720
     tggcactact cggtggtcgc ccgttacttc cataacggcg gtcagtggaa agatggcgac       780
     gagccggtat ggcaggccga accaattaag tccaacggct tcggctggta tctggtggtg       840
     ggttacaact tctaa                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page