(data stored in ACNUC8465 zone)

EMBL: FN543502.UHPA

FN543502.UHPA        Location/Qualifiers
FT   CDS_pept        complement(460301..460930)
FT                   /transl_table=11
FT                   /gene="uhpA"
FT                   /locus_tag="ROD_04091"
FT                   /product="two-component system response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04091"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87191"
FT                   /db_xref="GOA:D2TKV0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKV0"
FT                   /protein_id="CBG87191.1"
FT                   /translation="MIRVVLVDDHVVVRSGFAQLLSLEEDLEVAGQFSRAADAWPALLR
FT                   DDVSVAVMDIAMPDENGLSLLKRLRAQKPQFRAIILSIYDSPTFVQSALTAGASGYLTK
FT                   RCGPEELVQAVRSVGLGGHYLCADALRALRGGEQLPPELEALTPREREVFNLLVKGDSV
FT                   KEIAFKLDLSHKTVHVYRANVLGKLNCHSTIELVHFALDHKLLVGH"
     atgatacgtg tggtgctggt ggacgaccat gtggtggtgc gttccggctt tgcgcaatta        60
     ctcagtctcg aagaggacct tgaggtcgcg ggccagttca gccgcgcggc ggacgcgtgg       120
     cctgcgctgt tgcgcgacga cgttagcgtg gcggtgatgg atatcgccat gccggatgag       180
     aacggcctga gcctgctgaa gcgcctgcgg gcgcagaagc cgcagtttcg cgccattatt       240
     ctcagcatct atgattcgcc cacctttgta caaagcgcgc tgaccgccgg ggccagcggc       300
     tacctgacca agcgctgcgg gccggaggag ctggtgcagg cggtacgctc cgtcggcctg       360
     gggggacatt atctctgcgc cgacgcgctg cgggcgttgc gtggcggaga gcaactgccg       420
     ccggagctgg aagcgcttac tccgcgagag cgtgaagtgt ttaatctgct ggtcaaaggc       480
     gacagcgtta aggagatcgc ctttaagctc gacctcagcc ataaaacggt ccatgtgtat       540
     cgcgccaacg tgcttggcaa actgaactgc cacagcacca tcgagctggt gcatttcgcc       600
     ctcgaccata agctgctggt ggggcattaa                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page