(data stored in ACNUC8465 zone)

EMBL: FN543502.UHPC

FN543502.UHPC        Location/Qualifiers
FT   CDS_pept        complement(457365..458669)
FT                   /transl_table=11
FT                   /gene="uhpC"
FT                   /locus_tag="ROD_04071"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROD_04071"
FT                   /db_xref="EnsemblGenomes-Tr:CBG87189"
FT                   /db_xref="GOA:D2TKU8"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2TKU8"
FT                   /protein_id="CBG87189.1"
FT                   /translation="MHARQTTAIDQRYRALRLTLLLCMVTGYAAFYLTRKSVNYVLPAL
FT                   QTDLGLDKGDIGLLGSLFYLSYGLSKFTAGLWHDSHGQRGFMGAGLFATGVLNVAFAFG
FT                   ESLTLLLAVWTLNGFFQGWGWPPCARLLTHWYSRNERGFWWGCWNMSINIGGAIIPLIS
FT                   AFAAHWWGWQAAMLTPGIISMALGIWLTLQLKGTPREEGLPSVGAWRNDPLELRQEQLS
FT                   PPMGLWRMLRITMLRNPMIWLLGGSYVLVYLIRIALNDWGNIWLTESHGVNLLSANATV
FT                   MLFEVGGLLGALFAGWGSDLLFSGQRAPMILLFTLGLMVSVAALWLAPVHHYALLAACF
FT                   FTVGFFVFGPQMLIGLAAVECGHKAAAGSITGFLGLFAYLGAALAGWPLSLVIERYDWS
FT                   GMFSLLSIAAVLMGLLLMPLLMAGVSATLSQRIKQ"
     atgcacgcac gtcagacaac tgcaatcgat caacgctacc gggcgctgcg cctgacgctg        60
     ctgctgtgca tggtgacggg ctacgcggcg ttttatctga cgcgtaaaag cgtcaactat       120
     gtgctgccgg cgctgcaaac ggatctgggg ctggacaagg gcgatatcgg cctgctgggt       180
     tcgctgtttt atctgagcta tggcctgtcg aaatttaccg ccgggctatg gcatgacagc       240
     cacggacagc gcggttttat gggcgcaggg ttgttcgcga ccggcgtgct gaacgtggcg       300
     ttcgcctttg gcgagtcgct gacgctgctg ctcgccgtct ggacgctgaa cggttttttt       360
     cagggctggg gatggcctcc ctgcgcccgc ctgctgaccc actggtactc gcgcaacgag       420
     cgcggtttct ggtggggctg ctggaatatg tcgatcaaca tcggcggggc gattatcccg       480
     ctgatcagcg cctttgccgc ccactggtgg ggctggcagg cggcgatgct gacaccgggg       540
     attatcagca tggcgctggg gatctggtta acgctgcagc tgaaaggaac gccccgggaa       600
     gagggattgc cgtcagttgg cgcatggcgt aacgacccgc tggagctgcg ccaggaacag       660
     cttagcccgc cgatgggact atggcggatg ttgcgtatca cgatgttgcg aaatcccatg       720
     atctggctgt tgggcggctc ctacgtgctg gtgtatctca tccgcatcgc gcttaacgac       780
     tggggcaaca tctggctgac cgaaagccac ggcgtcaatc tgctgagcgc caacgccacg       840
     gtgatgctgt tcgaagtggg cggtcttctc ggcgcgctgt ttgccggctg gggatcggat       900
     ttgctgttca gcggccagcg ggcgccgatg attctgctgt tcacgctggg gctgatggtt       960
     tccgtcgccg cgctgtggct ggcgccggtc catcactacg cgctgctggc ggcctgtttt      1020
     tttacggtgg gcttctttgt cttcggcccg caaatgctga ttggccttgc cgccgtggag      1080
     tgcgggcata aagcggcggc gggatcgatc accggttttc tcggcctgtt cgcctatctg      1140
     ggggccgcgc tggcgggctg gcctctgtcg ctggttattg aacgctacga ctggtcggga      1200
     atgttcagtt tgctctcgat cgccgcggta cttatgggtt tactgctgat gcccctgctg      1260
     atggcaggcg tcagcgccac tctcagtcaa aggataaaac aatga                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page