(data stored in ACNUC1104 zone)

EMBL: FN667741.AMPH

FN667741.AMPH        Location/Qualifiers
FT   CDS_pept        complement(453358..454575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampH"
FT                   /locus_tag="XBJ1_0450"
FT                   /product="beta-lactamase/D-ala carboxypeptidase,
FT                   penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79600"
FT                   /db_xref="GOA:D3UW91"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79600.1"
FT                   /translation="MNKQLYKLFAVSALSWALSACAAPDNAHQNNFPQSGKKTTKWQVF
FT                   EGNDNTKKMASSLVDQYAQSIFDEGNPLGMAMVIIDNNQVVHRSFGETYPGSGARPRQD
FT                   SVIRLASITKLMTSEVMIKLAQKERLKITDPLQKYTYHGVRVPDYAITQPIRLYHLASH
FT                   TSGLPREQPGGKWGRPVFIWPTQSNRWAWLKTAGMNAAPGTTASYSNLAYDLLADALSK
FT                   ATGEPYTRLLQEEITRPYRMKDTTLTPSRSQCARLMEGVKPSPCLSTIAAAGSGGIYST
FT                   PVDMQRWMQQFLSSHNQLRKKTASREQGIYFKRENLTSITGMDVAGQADGIGLGWVYMD
FT                   AKKGVPGIYQKTGGGGGFNTYMAMIPEQNIGVFVVMTRKEQSKFSRVTNGVNELVAALS
FT                   RNHGKL"
     atgaacaaac agttatataa actttttgct gtttcagccc tgtcatgggc gctttcggct        60
     tgtgctgccc ccgataatgc acaccagaat aattttccgc aatcaggcaa aaaaaccaca       120
     aaatggcaag tttttgaggg taatgataat accaagaaaa tggcctcatc tctggtcgac       180
     cagtatgcac agtcaatctt tgatgaaggt aatccgttgg ggatggcaat ggtgattatc       240
     gataataatc aggtggtgca tcgcagtttc ggggagactt atccggggag tggagcccgt       300
     ccgcgacagg attcggtgat ccgccttgct tcgataacga aactgatgac cagcgaggtc       360
     atgattaagc tggcgcagaa ggaacgcctc aagatcaccg atccgttgca gaaatacact       420
     tatcatggtg tgcgtgtacc cgattatgcg ataactcaac cgatccgcct gtatcatctg       480
     gccagccata ccagcggcct gccacgagag cagccgggcg gaaaatgggg gcggccggtg       540
     tttatctggc caacacaatc aaatcgctgg gcttggctga aaacagcagg tatgaatgcc       600
     gctcccggta caacggcttc gtattccaat ctggcttacg atttactggc ggatgcgctc       660
     tctaaagcca cgggggaacc ctatacccgg ctgctacaag aagagatcac ccgcccttat       720
     cgcatgaagg atacgacact gacaccctct cgttcccaat gtgctcgttt aatggaaggg       780
     gttaagccca gtccctgtct cagtaccatc gccgcagcag gcagtggcgg gatttattcg       840
     actcccgtag atatgcagcg ctggatgcag cagtttttat cctcccacaa tcaattgagg       900
     aagaagaccg ccagccgtga gcagggtatc tattttaaac gtgaaaatct gacgtcaatc       960
     acaggaatgg atgtcgcggg tcaagcagac gggatcgggc ttggctgggt atatatggat      1020
     gccaaaaaag gggtgccggg catctatcag aaaaccggcg gcggcggcgg gttcaatacc      1080
     tatatggcga tgatccctga gcaaaatatc ggtgtgtttg tggtgatgac gcgcaaggaa      1140
     caaagcaagt tcagtcgtgt cactaacggg gtgaatgaat tggtcgcagc actgtcacga      1200
     aatcatggaa agttatag                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page