(data stored in ACNUC1104 zone)

EMBL: FN667741.AROK

FN667741.AROK        Location/Qualifiers
FT   CDS_pept        complement(65907..66428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0012"
FT                   /gene="aroK"
FT                   /locus_tag="XBJ1_0058"
FT                   /product="shikimate kinase I"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79209"
FT                   /db_xref="GOA:D3UY31"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79209.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIERRTGA
FT                   DVGWVFDVEGEEGFRDREEKIINELTEKQGIVLATGGGSVKSKETRNRLSARGVVVYLE
FT                   TTIEKQLARTQRDKKRPLLQVDAPAREVLENLADERNPLYEEIADLTIRTDEQSAKVVA
FT                   NQIIELLEKN"
     atggcagaga aacgcaatat ctttctggtt gggcctatgg gtgccggcaa aagcactatt        60
     ggtcgtcagt tagctcagca actcaatatg gagttttacg actctgatca agaaattgag       120
     cgacgtaccg gagctgacgt gggctgggta tttgatgtgg aaggcgaaga aggcttccgc       180
     gatcgtgaag aaaaaataat taacgaattg actgaaaaac aaggcatcgt actggcaacg       240
     ggtgggggtt ctgttaaatc aaaagaaacc cgtaatcgtc tgtctgcccg tggtgtggtt       300
     gtctatttag aaacaaccat cgaaaaacag ttagctcgta ctcagcgtga taaaaaacgt       360
     cctttacttc aagtggatgc accagcacgc gaagttttag aaaatttagc tgatgagcgc       420
     aaccctctct acgaggaaat tgctgatctg actatccgta cagatgagca aagcgccaaa       480
     gttgttgcta accaaatcat cgaattactg gaaaaaaact ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page