(data stored in ACNUC1104 zone)

EMBL: FN667741.ATPB

FN667741.ATPB        Location/Qualifiers
FT   CDS_pept        complement(31922..32749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0005"
FT                   /gene="atpB"
FT                   /locus_tag="XBJ1_0028"
FT                   /product="membrane-bound ATP synthase, F0 sector, subunit
FT                   a, important for FO assembly"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79183"
FT                   /db_xref="GOA:D3UY05"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79183.1"
FT                   /translation="MSASGEVLTSQEYISHHLKHLQLDLRTFELVNPHASGYETTFWTL
FT                   NIDSLFFSVILGILFLFVFRRVAVRATDGVPGKLQTAVEMVFGFVDNTVRDMYHGKSKV
FT                   IAPLALTVFVWVLLMNALDLLPIDLIPLIGERYFGLPALRIVPTADVSVTLSMALGVFV
FT                   LILFYSIKMKGIRGFAKELTLQPFNHPLFIPINLILEGVSLLSKPISLALRLFGNMYAG
FT                   ELIFILITALLPFWSQWLLSLPWAIFHILIITLQAFIFMVLTVVYLSMASEEH"
     atgtctgcat caggagaagt tttaacttcg caggagtaca taagtcatca cctgaagcac        60
     cttcagttag acttgcgtac ctttgagttg gtcaatcccc acgctagtgg ttatgagacg       120
     acgttctgga cgttgaacat tgactcgctt tttttctccg tcatattagg aatattgttt       180
     ctgtttgtat tccggagagt tgcggttcgc gctaccgatg gcgtaccggg taagctccag       240
     actgcggtag aaatggtttt cggtttcgtt gataacactg ttcgtgatat gtatcacggt       300
     aagagcaaag tgatagctcc cctggctttg actgtgttcg tctgggtgtt attaatgaac       360
     gcattggact tgctgccaat cgatttaatt cctttgatcg gtgaacgcta tttcggcctg       420
     cctgctctgc gtattgttcc aacagcagat gtcagtgtca ctctgtcgat ggcgctcggt       480
     gtctttgttc tcatcctgtt ctatagcatt aagatgaaag gaattcgtgg ttttgcgaag       540
     gagctgacat tacagccttt caatcaccca ctgtttattc caattaactt aattctggaa       600
     ggggtcagct tactatctaa acctatatca ctcgctctgc gactgtttgg taatatgtat       660
     gctggcgaat tgatctttat tcttattacg gctcttttac cgttttggtc acagtggtta       720
     ctcagcctgc catgggcgat tttccacata ctgattatca cgttacaagc ctttatcttc       780
     atggttctga cggttgttta tctatcgatg gcatctgaag aacattaa                    828
//

If you have problems or comments...

PBIL Back to PBIL home page