(data stored in ACNUC1104 zone)

EMBL: FN667741.ATPC

FN667741.ATPC        Location/Qualifiers
FT   CDS_pept        complement(26215..26637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0005"
FT                   /gene="atpC"
FT                   /locus_tag="XBJ1_0021"
FT                   /product="membrane-bound ATP synthase, F1 sector,
FT                   epsilon-subunit"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79176"
FT                   /db_xref="GOA:D3UXZ8"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:D3UXZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79176.1"
FT                   /translation="MAAMTFFLNVVSAEKRLFEGLVQKIQVTGSEGELGIYPQHTPLLT
FT                   AIKPGMIRIVKQFGEEEFIYLSGGVLEVQPNGVIVLADTAIRGKDLDEAKALEAKREAE
FT                   EHVRNSHGDVDYAQASAELSKAIAKLRVIELTKQRM"
     atggctgcaa tgacgttctt cctgaacgta gtcagcgctg aaaaacgatt gtttgaaggg        60
     ctggtacaaa aaattcaggt gactggcagt gaaggtgagc tgggtattta tcctcagcac       120
     acaccactgc ttactgccat aaaaccgggc atgatacgta ttgttaagca gtttggtgaa       180
     gaagaattta tctacctgtc cggtggagtt cttgaagttc agccaaacgg cgttatcgta       240
     ctggccgata cagcgatccg tggtaaggat ttggacgaag ccaaggcgct tgaagcgaag       300
     cgtgaggctg aagaacacgt ccgtaattct cacggcgatg ttgattatgc tcaggcatct       360
     gctgaattgt cgaaagcgat tgcaaaactt cgtgtaatcg aactgacaaa acaacggatg       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page