(data stored in ACNUC1104 zone)

EMBL: FN667741.ATPI

FN667741.ATPI        Location/Qualifiers
FT   CDS_pept        complement(32781..33158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0005"
FT                   /gene="atpI"
FT                   /locus_tag="XBJ1_0029"
FT                   /product="membrane-bound ATP synthase subunit, F1-F0-type
FT                   proton-ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79184"
FT                   /db_xref="GOA:D3UY06"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79184.1"
FT                   /translation="MSVSLYSGRIALKLLLLQLMTFIILSVAFCTRSIEWGASAFAGGL
FT                   ACWLPNAIFMLLTRFQKAKEEDVPVRIAWFFAIGEVAKVVITIAVLIVALGVFKAAFAP
FT                   LGVAYLAVLIVQIIAPAVMNG"
     atgtctgtat ccctttacag cggtagaatt gcactgaaac tgttactttt gcagttaatg        60
     acttttatta ttctcagtgt ggctttttgt accagaagta tcgaatgggg cgcttctgct       120
     tttgccggtg ggctggcgtg ctggctgcca aatgccattt ttatgctgct aactcgcttc       180
     caaaaagcaa aagaagaaga tgtaccagta cgcattgcat ggttcttcgc tattggcgaa       240
     gtggctaaag ttgtcattac gatagctgtg ctgatagttg ccttgggagt gtttaaggcg       300
     gcatttgcac cacttggtgt agcctattta gcggtgctga ttgtgcagat catcgcacct       360
     gccgtaatga acggttag                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page