(data stored in ACNUC1104 zone)

EMBL: FN667741.CLPB

FN667741.CLPB        Location/Qualifiers
FT   CDS_pept        279323..282037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0054"
FT                   /gene="clpB"
FT                   /locus_tag="XBJ1_0272"
FT                   /product="putative ClpA/B-type chaperone (Putative ATPase
FT                   with chaperone activity; probable component of SST VI
FT                   cluster)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79423"
FT                   /db_xref="GOA:D3UYP5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79423.1"
FT                   /translation="MIQIDLPTLVNRLNPMTRHALEAAAASCVSQQQPEITVAQLLFQM
FT                   IDTPLSDVRLILNKADIDKDLLKEQLDQMMPHHQAIVQTYPNFSPMLVEWLQDSWLLAS
FT                   TEMQHTELRGGVMLIALLFSPMRYLTPQPARMLAGINRELLRQNFTEWTNGSAEQPFSG
FT                   DDKNGQGVHPANSDSLLARFTQNMTEQARQGKLDPVLCRDNEIDLMIDILCRRRKNNPI
FT                   VVGEAGVGKSALIEGLALRIINDRVPDKLRHSELMTLDLGALQAGAAVKGEFEKRFKGI
FT                   MAEISQSSKPIILFIDEAHTLIGAGNQAGGLDISNLLKPALARGELKTIAATTWSEYKK
FT                   YFEKDAALSRRFQLVKVSEPSAEEATVIMRGLRAIYEQAHGVLIDDEALKASAVLSDRY
FT                   LSGRQLPDKAIDVLDTACARVAINLTSPPRQISSLTTELHQMQMEIDVLKREQRMGLNE
FT                   HADRLEELQNQQVEIQEELVTLEKNWRQQQELVTQIIELRGQLLADSDESVAAETTDKT
FT                   IENAVEETAQDAKEQEAIAQDEPEAAADEQSLIEKLALLNAQLTELQQKQTLVSPHVDK
FT                   TQIASVIAEWTGVPLNRLSQSELSIVTELPTHLGQSIKGQDVAIQNLHKHLLTARADLR
FT                   RPGRPLGAFLLVGPSGVGKTETVLQIAELMFGGRQYLTTINMSEFQEKHTVSRLIGSPP
FT                   GYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGELADGEGRIIDCK
FT                   NVVFFLTSNLGYQTIVDHAEQPDQLNDLLYPELAAFFKPALLARMEVIPYLPLGHETLK
FT                   TIIQSKLARLDSLLSQRFNAEVTISDDVSEEILQRATRAENGARMLESIIDGALLPPVS
FT                   LLLLQKMAAGTAISAIRLTVAEHEFHAEVEEAE"
     atgattcaga ttgatctgcc cactcttgta aaccgtttaa acccgatgac ccgccatgca        60
     ctggaagcgg cggcggcatc ctgtgtcagc caacagcagc ctgaaattac tgttgcacaa       120
     ctgttgtttc agatgatcga cacaccactc agtgatgtgc gcctgatcct caataaggca       180
     gacatcgata aagatctgct gaaagaacaa ctcgatcaga tgatgcctca tcatcaggcg       240
     attgtacaaa cctacccgaa cttctcaccg atgctggtgg aatggttaca ggatagctgg       300
     ctgctggctt ctacggagat gcagcatact gaattacgcg gtggcgtcat gctgattgct       360
     ctgctgttca gtccaatgcg ttatctgact ccacagcccg cgcgcatgct ggcgggtatc       420
     aaccgtgaat tgctgcgtca gaactttact gaatggacga atggctctgc cgaacagcct       480
     ttcagcggcg acgataaaaa tgggcagggc gtccatccgg caaacagcga cagcctgctg       540
     gcgcgtttta cccagaatat gactgaacag gcgcgtcagg gcaaacttga tcctgtgctg       600
     tgccgtgata acgaaatcga tctgatgatc gacattctct gccgtcgccg caaaaacaac       660
     ccgatcgtcg tgggtgaagc gggggtgggt aaaagtgccc tgattgaagg tctggcgctg       720
     cgcatcatca atgaccgcgt accggataaa ttgcgccaca gtgaactgat gacactggat       780
     ctgggggcat tgcaggcagg ggctgcggtt aaaggtgagt ttgaaaaacg cttcaaaggc       840
     atcatggctg aaattagtca atcatctaag ccgatcatcc tgtttatcga tgaagcgcac       900
     accctgattg gtgccggtaa ccaggctggc ggactggata tttccaatct gctgaaacct       960
     gcattggcac gtggtgaact gaaaaccatc gcagcgacta catggagcga gtacaaaaaa      1020
     tacttcgaaa aggacgcagc actgtctcgt cgcttccaat tagtgaaagt ctctgagcca      1080
     agcgcggaag aagccactgt gatcatgcgt ggtttgcgcg ccatttacga acaggcgcat      1140
     ggtgttctga tcgatgatga agcactgaaa gcctctgcgg tactgagtga ccgttatctc      1200
     tctggccgcc aactgccgga caaagcgatt gacgtactgg ataccgcctg tgcccgtgtc      1260
     gccattaacc tgacatcgcc accacgtcag atctcctcac tgacgactga attgcaccag      1320
     atgcaaatgg aaatcgatgt tctgaaaaga gaacagcgga tggggctgaa tgaacatgcg      1380
     gacagactgg aagaactgca aaaccagcag gtagagatcc aagaagaact cgtcacgctg      1440
     gaaaaaaact ggcggcaaca gcaagagttg gtgacacaga tcatcgaatt gcgcggccaa      1500
     ctcctggcgg atagcgacga gtcagttgca gcagaaacga cggataaaac catcgaaaat      1560
     gcggttgaag agacggctca agacgcgaaa gagcaggaag ctattgcgca agacgagcca      1620
     gaagccgccg ctgatgagca atccctgatc gaaaaactgg ctctgctcaa cgcacaactg      1680
     acagagttac agcagaagca aacgctggtt tctccccatg tagacaaaac gcagattgcc      1740
     tcggttatcg ctgagtggac gggcgttcca ttgaaccgcc tgtcacagag cgaactgtct      1800
     atcgtgaccg aactgcctac ccatctggga caaagcatca aagggcagga tgttgcgatc      1860
     cagaacctgc ataaacacct gctgaccgct cgtgcagatt tgcgtcgtcc gggacgtcct      1920
     ctgggcgcat tcctgctggt ggggccaagt ggtgttggta aaaccgaaac cgtgctgcaa      1980
     attgctgaac tgatgtttgg ggggcgccaa tacctcacca ccatcaacat gtctgagttt      2040
     caggagaaac ataccgtttc ccgcctgatt ggctctcccc cgggctacgt aggttatggg      2100
     gaaggtggtg tactgaccga agccattcgc cagaaaccgt actccgttgt gctgctggat      2160
     gaagtcgaaa aagcgcatcc tgatgtactg aacctgttct atcaggcctt cgacaaaggc      2220
     gaactggccg atggcgaagg gcgtatcatc gactgtaaaa atgtcgtgtt cttcctgact      2280
     tctaaccttg gttatcaaac tatcgttgat catgccgagc agccagatca acttaacgac      2340
     ctgctctacc ctgaactggc cgcgtttttc aaacccgcat tgctggcgcg tatggaagtg      2400
     atcccttacc tgcctttggg tcacgaaacg ctgaaaacca tcattcagag caagctggct      2460
     cgactggata gcctgctgtc tcagcgcttt aacgccgaag tcacgatcag cgatgacgta      2520
     tcggaagaga tcctgcaacg tgccacccgt gcggaaaacg gcgcccgtat gctggaatcc      2580
     atcattgatg gtgcactatt accgcctgtt tcattactgc tgttgcagaa aatggccgca      2640
     ggcaccgcaa tcagtgccat tcgcttaacc gtagcagaac atgagttcca tgctgaggtt      2700
     gaggaggcag aataa                                                       2715
//

If you have problems or comments...

PBIL Back to PBIL home page