(data stored in ACNUC1104 zone)

EMBL: FN667741.DAMX

FN667741.DAMX        Location/Qualifiers
FT   CDS_pept        complement(63611..64576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0011"
FT                   /gene="damX"
FT                   /locus_tag="XBJ1_0056"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79207"
FT                   /db_xref="GOA:D3UY29"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR032899"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79207.1"
FT                   /translation="MDELKSENKQKTENEFKPDTSDRHPPRSRSQSNQPKLAVSRQQLM
FT                   IGVGILVLLLLIIAISSALKSPTEHEKQQSQNTAEKNIDLSGSSSLSTNNQNSSPENPL
FT                   ASAINGSQEISMPPISNTPSKDLSPAPEASNHNQRIELPGDISDALNQQQGNINNTVQK
FT                   NLTPSQSNPMQQTVIPPVEQNKTEKVAPPKIEKTEKVAKSEKHAKSTDKPAIFHHQASK
FT                   KSVTDTRGDLLKASANRFTLQLSSASRSDTLIAFAKNNNLSNYTVYEAKREGKAWFILI
FT                   HGSYGSVSDAKSAISSLPAEVQAKKPWVRKLQQVQQDLKK"
     atggacgaat taaaatcaga aaacaaacaa aaaacagaaa acgaatttaa acccgataca        60
     tccgatcgcc accctccgcg atcgcgcagc caatccaacc agcccaagct ggcagtatcc       120
     cgccagcaat taatgattgg ggttggaatt ctggtgcttt tactgctgat tattgctatc       180
     agttctgcat tgaaatcgcc aactgagcat gagaaacagc aatcccagaa tacggctgag       240
     aaaaacatcg atctatccgg ctcttcttca ctctctacca ataatcagaa tagctcgccg       300
     gaaaatccat tggcatcagc aatcaatggc tcacaagaaa tcagtatgcc acccattagc       360
     aatacaccaa gcaaagatct ttctccagca cctgaggcaa gtaaccacaa ccagcgcata       420
     gaattgcccg gtgatatttc tgatgccttg aatcaacagc aaggtaacat caataatacg       480
     gtgcaaaaaa acctgacgcc atcacagtcc aacccgatgc aacagacggt gataccgcca       540
     gttgaacaga ataagactga aaaagttgca ccgccgaaaa tagaaaaaac ggaaaaagtg       600
     gcaaaatcag aaaagcatgc caaatcaact gataaaccag caatattcca ccatcaggcc       660
     agtaaaaaga gtgtgactga tactcgcggt gatttactga aagcctccgc caacagattc       720
     acactccagt tgagtagcgc cagccgctcg gataccttaa ttgccttcgc aaagaacaat       780
     aacctgtcaa actatacggt ttatgaagct aaacgtgaag gtaaggcatg gtttatcttg       840
     atccacggca gttatggttc ggtttctgac gccaaaagtg ccatttcctc actcccggct       900
     gaagttcagg ccaaaaaacc ttgggttaga aaactacaac aggttcagca agatctgaaa       960
     aaataa                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page