(data stored in ACNUC1104 zone)

EMBL: FN667741.DNAE

FN667741.DNAE        Location/Qualifiers
FT   CDS_pept        621716..625150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0119"
FT                   /gene="dnaE"
FT                   /locus_tag="XBJ1_0604"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0604"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79748"
FT                   /db_xref="GOA:D3UWH4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79748.1"
FT                   /translation="MIDGLAKTGSLIKKVAKLDMPAFAITDFTNLCGLVKFYGSAHSAG
FT                   IKPIIGADFYVESDLLGDEYAHLTILARNNEGYQNLTFLISEAYQKGYGAIGPTIKQEW
FT                   LIKYKAGLILLSGGRMGDVGKFLLRGNRAMADQCLDFYQEHFPDSYYLELIRTGRQDEE
FT                   NYLHAAVEVAAEKNLPVVATNDVCFLESDDFEAHEIRVAIHDGYTMADPKRPKNYSPQQ
FT                   YLRSEQEMCELFSDIPEALQNSVEIAKRCNVTIRLGEYFLPQFPTGDMSTEDYLVEKSK
FT                   QGLEDRLNFLYPDPQIRAEKRSEYDERLDIELEVINQMGFPGYFLIVMEFIQWSKDNGV
FT                   PVGPGRGSGAGSLVAYALKITDIDPLAFDLLFERFLNPERISMPDFDVDFCMEKRDQVI
FT                   DHVADMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLVPPDPGMTLEKA
FT                   FAAEPQLPEIYEADEEVRVLIDMARKLEGVTRNAGKHAGGVVIAPTKITDFSPIYCDPE
FT                   GLNPVTQFDKNDVEYAGLVKFDFLGLRTLTIINWALDMVNARRTHKNLEPIDITAIPLD
FT                   DQISFDMLQRSETTAVFQLESRGMKDLIKRLRPDCFEDMIALVALFRPGPLQSGMVDNF
FT                   IDRKHGREELSYPDVEWQHESLKPVLEPTYGIILYQEQVMQIAQVLAGYTLGGADMLRR
FT                   AMGKKQPEEMAKQRSVFEEGAISQGINGELAIKIFDLVEKFAGYGFNKSHSAAYALVSY
FT                   QTLWLKAHYPAEFMAAVMTADMDNTEKVVGLVDECWRMGLKVLPPDINSGLYHFHVNDE
FT                   SEIVYGIGAIKGVGEGPIEAILEARQKEGHFKELFDLCARVDTKKLNRRVMEKLIMSGA
FT                   FDRLGPHRAALMSSLEDALKAADQHAKAEAIGQTDMFGVLAEKPEQVELSYASTPKWPE
FT                   QVVLDGERETLGLYLTGHPITSYLKEIERYTNGLRLKDVSPTPRGQVTTVVGLVLASKI
FT                   LTTKRGNRIGICTLDDRSGRLEIMLFSDALERYQHLLEQDKILIATGQVSFDDFSGGLK
FT                   MTVRELMDISEAREKFARGIAISLSDRQINKQLFNRLRGVLEPHRSGTIPVHLYYQRVD
FT                   ARARLRFGATWRVTPTDTLLTDLRTLLGNEQVELEFD"
     atgattgacg gtttagccaa aacagggtca ctgataaaaa aagtggctaa attggatatg        60
     cctgcttttg cgatcactga ttttactaac ctgtgcggct tggtgaaatt ctatggcagt       120
     gcccatagtg caggtatcaa gccgattata ggcgctgatt tttatgtgga aagtgatctg       180
     ctgggggatg aatatgccca tctgacgatc cttgcccgta ataacgaagg ttatcaaaac       240
     ctaacctttt tgatctccga agcttatcag aaaggctatg gtgcgattgg tccgacgatc       300
     aaacaagaat ggctgataaa atacaaagcc ggcttgattc ttctgtctgg tgggcgaatg       360
     ggggatgtcg gcaaattctt actgcgcgga aatcgggcga tggcggatca gtgcctcgat       420
     ttctatcagg aacattttcc ggacagctat taccttgaat tgatccgtac aggacgtcaa       480
     gacgaagaaa attatcttca tgctgccgtc gaagtggcag cagaaaaaaa cttacctgtt       540
     gtggcaacta atgacgtttg tttcctggaa agtgacgact ttgaagccca tgagattcgg       600
     gttgccattc atgatggcta tacgatggct gatccaaaac gccctaaaaa ctatagccct       660
     cagcagtatc tgcgcagtga acaggagatg tgtgagctat tctctgacat tcctgaagcg       720
     ctgcaaaata gtgtcgaaat tgctaaacgc tgcaatgtga ctattcgtct cggtgaatat       780
     ttcctgccac agtttccaac aggggatatg agcactgaag actatctggt tgaaaagtcg       840
     aagcaaggcc tggaagatcg tctgaatttt ctctatcccg atccgcaaat cagagcggaa       900
     aaacgttccg aatacgatga gcgtctggat atagagctgg aagttatcaa ccaaatgggc       960
     ttccccggct attttctgat cgtgatggaa tttatccaat ggtcgaaaga taatggcgta      1020
     cccgtagggc cggggcgtgg ttccggtgcg ggttcccttg tcgcctacgc cttgaaaatt      1080
     accgatattg acccgttggc atttgacttg ctgttcgaac gtttcctcaa ccctgaacgt      1140
     atttcgatgc ctgactttga cgtcgatttc tgtatggaaa aacgtgatca ggtgattgac      1200
     cacgttgcgg atatgtacgg gcgggatgcg gtatcgcaga tcatcacttt cggtacgatg      1260
     gcggcaaaag ccgttattcg tgacgttggg cgtgtattgg ggcacccata tggctttgtt      1320
     gatcgaatat cgaaactagt gcctcctgat cctggcatga cgttggaaaa ggcatttgcg      1380
     gctgaacctc aattgcctga aatttacgag gcggatgaag aagtcagggt gctgattgac      1440
     atggctcgca aattggaagg tgtcacccgt aacgccggta aacatgcggg tggtgtggtc      1500
     attgccccga ccaagatcac tgatttttca ccgatttact gtgatccgga aggcctgaac      1560
     cccgtcactc agtttgataa gaacgatgtg gaatatgcgg gtctggtgaa gtttgacttc      1620
     cttggcctga gaaccttgac cattatcaac tgggcgcttg atatggtgaa cgcccgtcgt      1680
     actcataaaa atctggaacc gattgatatt acggcaattc cgctggatga ccagataagt      1740
     ttcgatatgc tgcaacgctc tgaaactacg gcggtgttcc aacttgaatc ccgtgggatg      1800
     aaagatctga tcaaacgcct gcgtcccgac tgtttcgaag atatgatcgc attagtggcg      1860
     ctgttccgtc cggggccatt acaatccggt atggtggata actttatcga ccgtaaacac      1920
     gggcgggaag agctttcata cccagatgtt gagtggcagc acgaatcctt gaagcccgta      1980
     ctggagccaa catacggtat tattctgtat caggaacagg tgatgcagat tgctcaggtg      2040
     ctggcaggtt ataccctcgg tggtgcagat atgctccgtc gcgcaatggg taagaagcag      2100
     ccggaagaga tggctaaaca gcgctcggta tttgaagagg gcgcgataag ccaaggtatt      2160
     aatggcgaac tcgccataaa aatcttcgat ttggtggaaa aattcgcggg ttatggtttc      2220
     aacaaatctc actctgctgc ctatgcgtta gtttcttatc aaaccttatg gttaaaagct      2280
     cattatccgg cagaatttat ggcggccgtg atgacggcgg atatggataa cacagaaaaa      2340
     gtcgttgggc tggtggatga atgctggcgc atggggctta aggttttacc accggatatc      2400
     aacagtggtc tgtatcattt ccatgtcaat gacgaaagcg aaattgttta cggcattggt      2460
     gcgattaaag gtgtgggtga agggccgatt gaagcaatcc tcgaagcacg tcaaaaagag      2520
     gggcatttca aagaactgtt tgatctgtgt gcgcgtgttg ataccaaaaa gctgaaccgt      2580
     cgtgtgatgg aaaagctgat tatgtcagga gcgtttgaca ggctgggacc acatcgtgcg      2640
     gccttgatgt cttcgttgga agacgcgttg aaagcggctg atcaacatgc taaagcagaa      2700
     gccattggcc agacagatat gtttggtgtg ctggctgaaa aaccagagca ggttgagctt      2760
     tcatatgcca gtacaccgaa atggccagaa caagtcgtgt tagatggtga gagggaaacg      2820
     ctggggttgt atttaacggg tcacccgatc acaagttatt tgaaagagat tgaacgatat      2880
     acgaatggat tgcgtctaaa agatgtgagc ccgacacctc gtggtcaagt cacgactgtg      2940
     gtaggtttgg tgctggcatc caaaatcttg acaaccaaac gaggcaatcg gattggcatc      3000
     tgtactttgg atgatcgttc aggacggctg gaaatcatgc tgttttctga tgcactggaa      3060
     aggtatcagc atttattgga acaggacaaa attttaattg ctaccgggca agtcagcttt      3120
     gatgacttca gcggcggcct taaaatgaca gtccgtgaat taatggatat cagtgaggcg      3180
     cgtgaaaaat ttgcacgcgg gatagctatc tcgttatcag acaggcaaat taataaacaa      3240
     ttatttaatc gtctccgtgg cgtattggag ccgcatcgtt caggtacgat accagttcat      3300
     ctttattacc agcgggtaga tgcccgtgcc cgtttacgat tcggtgcaac atggcgggta      3360
     acgccgacgg ataccctttt gacagatctg cgaactctgc tgggtaacga gcaggtagaa      3420
     ttagaatttg actaa                                                       3435
//

If you have problems or comments...

PBIL Back to PBIL home page