(data stored in ACNUC1104 zone)

EMBL: FN667741.DPPD

FN667741.DPPD        Location/Qualifiers
FT   CDS_pept        253047..254027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0050"
FT                   /gene="dppD"
FT                   /locus_tag="XBJ1_0249"
FT                   /product="dipeptide transport protein (ABC superfamily,
FT                   atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79400"
FT                   /db_xref="GOA:D3UYM2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79400.1"
FT                   /translation="MALLNVDQLSVHFGEENAPFRAVDRISYSVEQGQVVGVVGESGSG
FT                   KSVSSLAIMGLVDYPGRVMAEKLEFNGRDLTKISEKERRQLVGAEVAMIFQDPMTSLNP
FT                   CYTVGFQIIEALKVHQGGSRKTRYQRAVDLLTLVGIPDPASRLDVYPHQLSGGMSQRVM
FT                   IAMAIACRPKLLIADEPTTALDVTIQAQIIELLLELQQQENMALVLITHDLALVAEAAH
FT                   HIIVMYGGQVVEAGKATEIFRAPRHPYTQALLRALPEFSTDKSRLASLPGVVPGKYDRP
FT                   TGCLLNPRCPYANEHCRQVEPALKTVGESQVKCHMPLDDEGRPTV"
     atggcattgt tgaatgtaga tcaattatcg gtgcacttcg gtgaagaaaa tgcgccattc        60
     cgcgccgttg accgtatcag ctacagtgtg gagcagggac aggttgtcgg ggttgttgga       120
     gaatccggct caggtaagtc cgtcagttca ctggcaatta tggggttggt tgattatccg       180
     ggcagggtca tggcagaaaa actggaattc aatggccgtg atctgacaaa aatttctgag       240
     aaagagcgtc gccagttggt cggtgcggaa gtggctatga tcttccaaga tccgatgacc       300
     agcttaaatc cgtgctatac cgtgggattt cagattatag aagcgcttaa agtacatcag       360
     ggggggagtc gcaaaacccg ttaccagcgg gcggttgatt tgttgacgct ggtgggtatt       420
     cctgatccgg cttcccgtct ggatgtctat ccacaccaat tgtctggtgg gatgagccag       480
     cgcgtcatga ttgctatggc gattgcctgt cgtcctaagc tgctgattgc cgatgaacct       540
     acgacggcac tggatgtaac tattcaggca caaatcatcg aattgctgct ggagttgcaa       600
     cagcaggaaa acatggcgct ggtcttgatc acgcatgact tagcgttagt ggcggaagcg       660
     gctcatcata tcatcgtgat gtatggcggg caggtagtgg aagcgggcaa ggcaactgaa       720
     atcttccgtg cgccccgtca tccttacaca caggcattat tacgggcgtt gccggaattt       780
     tcgacggata aatcccgtct ggcgtcgttg cccggtgtgg ttccgggcaa atatgaccgc       840
     ccgacagggt gtctgctcaa tccccgttgc ccctatgcga atgaacattg ccgtcaggta       900
     gagccagcat tgaaaacagt tggggaaagt caggttaaat gtcatatgcc gctggatgat       960
     gaggggagac cgacagtatg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page