(data stored in ACNUC1104 zone)

EMBL: FN667741.ECFK

FN667741.ECFK        Location/Qualifiers
FT   CDS_pept        614430..616865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0119"
FT                   /gene="ecfK"
FT                   /locus_tag="XBJ1_0597"
FT                   /product="putative outer membrane antigen"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0597"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79741"
FT                   /db_xref="GOA:D3UWG7"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79741.1"
FT                   /translation="MISPASKVGDRLGKRITTMAMKKLLIASLLFGSATAYSSDGFVVR
FT                   DIHFEGLQRVTSGAALLNMPVRVGDTISDEDISRTIHTLFATGNFEDVRVLRDGNTLVV
FT                   QVKERPTIASITFSGNKSVKDDMLKKNLESSRVSVGEALDRTMLSNMEKGLEDFYYSVG
FT                   KYNATVKAVVTPLPRNRIDLKLIFSEGISAQIQQINIVGNKAFSTNELLNRFQLRDDIP
FT                   WWNFMADQKYQKQKLAGDLETLRSFYLDRGYARFNIDSTQVNLTPDKKGIYITVNINEG
FT                   AQYKIASVDLNGNLAGYQSEATKLTNIQPGSLYNGTEVTSMEKAIKNLLGRYGYAYPRV
FT                   ITQPEINDTDKTVKLHVNVDAGNRFYVRKIRFEGNDISRDSVLRREMRQMEGAWLGSDR
FT                   VEQGKERLDRLGFFETVNVDTERVSGSPDLVDVVYKVKERNTGSMNFGVGFGTESGMSF
FT                   QVGLQQENWLGTGNSVGISASKNDYSTSADLSFTDPYFTVDGVSLGGRVYYNDFRADDA
FT                   ELSGYTNKAYGTEGILGFPLNENNRLAMRLGYAHNSLSNMRPQAAMWRYLKKMGKEPPL
FT                   KGKASFDSNDFPLTFSWIYGNFDRGFFPTSGFKSSVDAKVALPGSDNQYYKLTWSATGY
FT                   YPIDDKNSWIMMGRTRMGYGGGLGGKEMPFYENFYAGGSNSVRGFRSNNIGPKAIYLGE
FT                   NKEPEKNSPSRDAVGGNALATASFELITPTPFLDAKYANTVRTSFFVDAGTVWDTNWNN
FT                   ISPGLPDYSKPNNIRVSAGIALQWLSPLGPLTFSYGKPIKEYEGDRAEQFQFNIGGTW"
     atgatttctc ccgcttctaa ggtgggagac cggttaggaa aacgcataac aacgatggcg        60
     atgaaaaagt tgctcatagc gtcgctgctg ttcggcagcg ccactgcata cagttcagac       120
     ggattcgtgg ttcgggacat tcattttgag ggtcttcaac gtgtcacttc tggtgcagca       180
     ttactgaata tgccagttcg cgtaggtgat acaatcagcg atgaggatat cagtcgcacg       240
     attcatacac tgttcgcgac tggaaacttt gaagatgtcc gtgtcttgcg tgatggcaat       300
     acactcgtcg ttcaggttaa agaacggcca accatcgcca gcattacttt ctccggtaac       360
     aaatcggtga aagatgacat gctcaagaaa aaccttgagt cctctcgtgt tagtgttggt       420
     gaagctcttg accgcaccat gctgtctaat atggaaaaag ggctggaaga tttttactac       480
     agtgttggta aatacaatgc tacggtgaaa gccgttgtca cgccgctgcc ccgtaaccgt       540
     attgatttga aactcatatt ttcagaaggg atctcagcgc agatccagca gattaatatt       600
     gtcggcaata aagcattttc tacaaatgaa ttgctcaacc gtttccagct cagggatgat       660
     attccttggt ggaactttat ggctgaccag aaataccaga aacagaaatt ggcgggtgat       720
     cttgaaactt tgcgcagttt ctaccttgat cgaggttatg cccgcttcaa tattgattcg       780
     actcaagtca atctgacgcc agataaaaaa ggtatctata tcaccgtgaa tatcaatgaa       840
     ggcgctcagt acaagatcgc cagtgttgat ttgaacggta atttggccgg ttatcagtct       900
     gaagccacaa aactgaccaa cattcagcct gggtcgctgt ataacggtac agaagtgacc       960
     tcgatggaaa aggcaattaa aaacctgctt ggtcgttatg gctatgccta cccacgagtg      1020
     attacacagc ctgaaatcaa cgatacagac aaaacggtta agttacatgt taatgtggat      1080
     gcaggtaacc gtttctatgt gcgtaaaatc cgcttcgaag gtaatgatat tagcagagac      1140
     tctgtgcttc gccgcgaaat gcgtcaaatg gaaggggcat ggctaggcag cgatcgcgtt      1200
     gaacagggca aagagcgtct ggacagactg ggcttttttg aaacggttaa tgtggataca      1260
     gaacgtgtat ccggtagccc agatttggtt gatgtggttt ataaagtcaa agaacgcaat      1320
     acgggttcta tgaactttgg tgttggtttc ggtactgaaa gtggcatgag cttccaggtc      1380
     ggtcttcagc aggaaaactg gctgggaacg ggtaactctg tggggatcag tgccagcaaa      1440
     aatgactatt cgacctctgc ggatttgtcc tttaccgatc cttacttcac agtggatggc      1500
     gtaagtctgg gcggtcgtgt gtactataac gatttccgtg cagatgatgc cgaactctct      1560
     ggttatacca ataaagccta cggtactgaa ggtattttgg gcttcccgct gaatgaaaat      1620
     aacaggttgg ccatgagatt gggctatgcc cataactcac tgtcgaacat gcgtccacag      1680
     gcagcgatgt ggcgttattt gaaaaaaatg ggcaaagagc cacctttgaa gggcaaggca      1740
     tcgttcgatt ccaatgattt cccactgaca ttcagttgga tatatggcaa ctttgaccgt      1800
     ggtttcttcc caacttcggg tttcaagtct tcagtggatg ccaaagtggc tctgccaggc      1860
     tcagacaacc agtactataa acttacttgg agcgctacag gttattatcc gattgatgat      1920
     aaaaattcat ggataatgat ggggcgcacc cgcatgggct atggtggcgg tcttggtggc      1980
     aaggaaatgc cattctatga aaacttctat gctggtggtt ctaatagtgt ccgtggtttc      2040
     cgttcgaata atatcggtcc aaaagcgatt tatttaggtg agaacaaaga accagaaaaa      2100
     aatagtccat cccgtgatgc tgtggggggg aatgcgttag cgactgccag ctttgagctg      2160
     attacgccaa caccgttcct ggatgcgaaa tatgccaata ctgtacggac ttccttcttt      2220
     gttgatgcgg gaaccgtgtg ggataccaac tggaacaata tttcccctgg tctgcctgac      2280
     tacagcaagc caaataatat ccgtgtttcg gccggtattg cattgcaatg gttgtcaccg      2340
     ttggggccat tgaccttctc ttatgggaag ccaatcaagg aatacgaagg tgatagagcg      2400
     gagcagttcc aatttaacat cggcggcact tggtag                                2436
//

If you have problems or comments...

PBIL Back to PBIL home page