(data stored in ACNUC1104 zone)

EMBL: FN667741.FEOA

FN667741.FEOA        Location/Qualifiers
FT   CDS_pept        complement(160770..161000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0034"
FT                   /gene="feoA"
FT                   /locus_tag="XBJ1_0165"
FT                   /product="ferrous iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79316"
FT                   /db_xref="GOA:D3UYD8"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79316.1"
FT                   /translation="MSLLPNRSYKILGFSAQISPAYRQKLLSLGMLPGSTFQVIRVAPL
FT                   GDPVQIETRRVNLILRKKDLAFITLDNTPLE"
     atgtcacttc ttccaaatcg aagttataaa attctggggt tttctgcaca gattagcccc        60
     gcctatcggc agaaattatt gtcactcggg atgttgcctg gttccacatt tcaggtcatt       120
     cgcgtggctc ctttaggcga tcctgtacaa atcgaaacac gcagagtcaa tctgatcctg       180
     cgtaaaaaag acttagcgtt tatcacacta gataacaccc cacttgaatg a                231
//

If you have problems or comments...

PBIL Back to PBIL home page