(data stored in ACNUC1104 zone)

EMBL: FN667741.FEOB

FN667741.FEOB        Location/Qualifiers
FT   CDS_pept        complement(158393..160705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0034"
FT                   /gene="feoB"
FT                   /locus_tag="XBJ1_0164"
FT                   /product="ferrous iron transport protein B (FeoB family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79315"
FT                   /db_xref="GOA:D3UYD7"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79315.1"
FT                   /translation="MKQLTIGLIGNPNAGKTTLFNQLTGSRQRVGNWAGVTVERKTGRF
FT                   TTDEQQIELVDLPGTYSLTTISEQTSIDEQIACHYILSGEADMLINVVDASNLERNLYL
FT                   SLQLIELGIPCIVALNMLDIAKNQHINIDIAALEQRLGCPVIPLVSTRATGIDTLKKAI
FT                   DHYQPSSQPVRIEYPDSLLQEVNHLASQITQNFNPQQRRWLTLQVLEGDIYSRERAGLT
FT                   QSQLAESKMRLQQQQLDEPELVIADSRYQAINALCLAVIDTHAATPHKLTQVMDKVILN
FT                   RWLGVPIFLFVMYLMFVLAINLGGALQPIFDGASTAIFIDGMRWLGHTLHFPDWLTVFL
FT                   AQGVGGGINTVLPLVPQIGLMYLFLSFLEDSGYMARAAFVMDRLMQSLGLPGKSFVPLI
FT                   VGFGCNVPSVMGSRTLDAPRERLITIMMAPFMSCGARLAIFAVFAAAFFGKSGASIVFS
FT                   LYILGITVAVLTGLLLKHTLMRGEASPFVMELPVYHVPHAKTLLLQSWQRLKGFVIRAG
FT                   KVIVAASILIGALNSFSFSGKAVDNINESALASVSKVITPLLYPIGVHSDNWQATVGLI
FT                   TGAMAKEVVVGTLNTLYTAENLNQAPFNPDEFHLLNELKGAVAETWDSLKETFTLSALS
FT                   NPIEASKGDGNMDSGAMGTMSAKFGSAISAYSYLIFVLLYVPCVSVMGAIARETSRGWM
FT                   LFSILWGLDVAYSLAAVFYQVTTFSAHPQSSLITILAVIVFNVLVFIGLRRARSRVTMT
FT                   FNNTAGRSCECSNGSCH"
     atgaaacaat taacaatagg tctgatcggt aatccgaatg ccggcaaaac cacgctgttc        60
     aaccaactca ccggctcccg gcaacgggta ggtaactggg caggtgttac ggtagaacgc       120
     aagaccggcc gttttaccac cgatgagcag caaatcgagc ttgtcgacct tcccggaacg       180
     tattccctca cgaccatttc ggagcagacc tccattgatg aacagattgc ctgccactac       240
     attctcagtg gtgaagccga tatgttgatc aatgtcgttg atgcttccaa tctggaacgc       300
     aatctctatc tctcgctgca actaattgaa ctgggcatcc cctgtattgt cgctctgaat       360
     atgctggata tcgccaaaaa ccaacatatc aacattgata ttgcggcgct ggagcaacgc       420
     ctcggctgcc cggttattcc gctggtttct acccgtgcca cggggatcga tacactgaag       480
     aaagccatcg accattatca accgtcttcc caacctgtac ggattgaata tcccgattcc       540
     ctgttgcagg aagtcaatca tcttgccagc cagataactc agaatttcaa cccgcaacag       600
     cgccgctggc tgactttgca ggtgctggaa ggggacattt acagccgtga gcgagcagga       660
     ctaacgcagt cgcagctcgc tgagagcaaa atgcgcctgc aacagcagca gcttgacgag       720
     ccggaactgg ttatcgccga ttcacgctat caagcgatta atgcgctgtg cctggctgtc       780
     attgataccc atgccgcgac accgcacaag ctgactcaag tgatggataa agtgatcttg       840
     aaccgctggc tgggtgtgcc gattttcctg ttcgtcatgt atctgatgtt tgtgctggcc       900
     atcaatcttg gtggcgcgct gcaaccgata ttcgatggtg cttccaccgc cattttcatt       960
     gatggtatgc gctggctcgg ccacacactt cacttcccgg attggttgac ggttttcctt      1020
     gcccaaggcg ttggtggggg gatcaacacg gtgctgccac tggttcctca aatcggcctg      1080
     atgtacctgt tcctttcctt tcttgaagac tcaggctata tggctcgtgc cgcatttgtg      1140
     atggataggt taatgcaatc actgggttta ccgggtaaat ctttcgtacc cttgattgtc      1200
     ggctttggct gtaacgttcc ttccgtgatg ggctccagaa cattagacgc accgcgtgaa      1260
     cggctgatca ccatcatgat ggcgcctttt atgtcctgcg gagcacgact ggccatcttt      1320
     gccgtctttg ctgccgcctt ctttggtaaa agcggtgcca gcatcgtctt ctcgctgtat      1380
     atactcggta tcacagtcgc tgtcctgacc ggcctgctcc tcaaacacac cctgatgcgc      1440
     ggtgaagcat cgccattcgt catggaactg ccggtctatc acgtccccca tgccaaaacc      1500
     ctgctgctcc agtcatggca gcgtctgaaa ggttttgtga tccgtgcagg taaagtgatc      1560
     gttgcagcca gcatactcat tggtgccctg aatagtttct ccttctccgg caaagcggtg      1620
     gataacatca acgaatctgc gctggcttct gtcagtaagg tgatcacacc actcctgtat      1680
     cctatcggcg tacattccga taactggcag gcgacggttg gcctgatcac cggtgcgatg      1740
     gcaaaagagg ttgtcgtcgg tacgctgaat accctgtata ccgctgagaa cctcaaccaa      1800
     gcgccattca atccggatga attccatctg ctgaatgaac tgaaaggtgc cgttgcggag      1860
     acatgggaca gcctgaaaga gacatttacc ctgagtgccc tttccaaccc gattgaggcc      1920
     agtaaaggcg atggcaatat ggatagcggc gcgatgggaa cgatgagtgc caaatttggt      1980
     tccgccattt ccgcttacag ttatctgatt ttcgtactgc tgtacgtacc ctgtgtttcg      2040
     gtaatggggg cgattgcccg tgaaaccagc cgtggctgga tgctcttctc catcctgtgg      2100
     ggattagatg tcgcttattc gctggcggca gtgttctatc aagtcacgac attttcggcg      2160
     catccacaaa gcagcctgat taccattctg gccgtgattg tatttaacgt actggtcttt      2220
     atcggcttac gccgtgctcg cagcagagtc accatgacgt tcaataacac cgcaggccgg      2280
     agctgcgaat gctctaacgg tagctgtcac tag                                   2313
//

If you have problems or comments...

PBIL Back to PBIL home page