(data stored in ACNUC1104 zone)

EMBL: FN667741.FRDA

FN667741.FRDA        Location/Qualifiers
FT   CDS_pept        complement(538578..540374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0106"
FT                   /gene="frdA"
FT                   /locus_tag="XBJ1_0537"
FT                   /product="fumarate reductase, anaerobic, catalytic and
FT                   NAD/flavoprotein subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79681"
FT                   /db_xref="GOA:D3UZ99"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79681.1"
FT                   /translation="MQTFNADLAIIGAGGAGLRAAIAAAEANPQLKIALISKVYPMRSH
FT                   TVAAEGGSAAVTQSHDSYDFHFNDTVSGGDWLCEQDVVEYFVKHCPTEMIQLEQWGCPW
FT                   SRKEDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLKYPQIQRFDEHFVLDILV
FT                   DEGQVRGLVALNMMEGTKVQIRANAVIMATGGAGRVYRYNTNGGIVTGDGMGMAFRHGI
FT                   PLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKDGYRYLQDYGMGPETPLGQPENK
FT                   YMELGPRDKVSQAFWHEWQAGRTIATPRGDVVHLDLRHLGEKKLLERLPFICELAKAYV
FT                   GVDPVKEPIPVRPTAHYTMGGIETNPQCETRIKGLFAIGECASVGLHGANRLGSNSLAE
FT                   LVVFGRLAGEEAVRHIQQTTPANENALDAQARDIENKLNKLLNQKGIESWAKIRDELGI
FT                   SMEEGCGIYRTPELMQKTMDKITELKERFRHIEITDRSSVFNTDLLYTIELGFGLDVAE
FT                   CMAHSAMNRKESRGAHQRLDAGCTERDDENFLKHTLAFYNPEGAPRLEYSDVKITISKP
FT                   AKRVYGGEAAAQDKQQKEQANG"
     gtgcaaacct tcaatgccga tctagccatt atcggagccg gtggcgcagg cttacgggca        60
     gccatcgctg ccgctgaagc caatccccaa ctcaagattg ccctgatctc aaaagtttat       120
     cccatgcgca gccacaccgt ggccgcagaa ggcggatcag ccgccgtcac tcaatctcat       180
     gactcctatg actttcactt caatgacacc gtgtcgggtg gcgactggtt atgtgaacaa       240
     gatgtggttg agtatttcgt caaacactgc ccgacagaaa tgatccaact ggagcaatgg       300
     ggttgtccct ggagccgtaa ggaagacggt tccgtgaacg tgcgtcgttt cggcggcatg       360
     aaaatcgaac ggacatggtt tgccgcagat aaaaccggct ttcatatgct ccatacgctg       420
     ttccagactt ccctgaaata cccgcaaata caacgcttcg atgagcactt tgtgctcgat       480
     attctggtag atgaagggca ggtgcgcggt ttggttgcac tgaatatgat ggaaggaacg       540
     aaagttcaga tccgcgccaa tgcggtcatt atggcaacgg gcggggcagg acgcgtgtac       600
     cgttataata ccaatggcgg cattgtcacg ggagatggca tgggaatggc attccgccac       660
     ggcataccac tgcgtgatat ggagtttgta caatatcacc caaccggcct gccgggttct       720
     ggtattttga tgacagaagg ctgccgtggt gaaggtggca ttctggtgaa caaagatggc       780
     taccgctatc tacaggatta tgggatgggg ccagagacgc cccttggtca acccgaaaac       840
     aaatatatgg aactggggcc aagagacaaa gtttctcagg ctttctggca tgaatggcag       900
     gcaggccgta ctatcgcgac gccgcgtggt gatgtggttc atctggatct gcgccattta       960
     ggtgagaaaa aactgctcga acgcttgcca ttcatctgtg agttggcaaa agcctatgtc      1020
     ggtgttgatc cggttaaaga accaattcct gttcgcccaa cggcacatta caccatgggt      1080
     ggaatcgaaa ctaacccgca gtgtgaaacc cgtatcaaag gactgtttgc tattggcgaa      1140
     tgcgcttccg tcggcctgca tggggcaaac cgcctcggtt ccaattcatt ggcagaactg      1200
     gtggtatttg gccgtttggc aggtgaagaa gccgtcagac atattcagca aaccacacct      1260
     gccaatgaaa acgcgctgga tgcacaagcc cgtgatatcg aaaataaact caataagctg      1320
     ctgaatcaga aaggtattga aagctgggcg aaaatccgtg atgaactggg tatttcaatg      1380
     gaagaaggct gtgggattta ccgtactcca gagctgatgc agaaaaccat ggataaaatt      1440
     acggaattga aggaacgctt caggcatatc gaaatcactg accgttccag tgtgttcaat      1500
     actgatctgc tctacacaat tgaactgggc tttggtctgg atgtcgctga atgtatggcg      1560
     cattctgcca tgaaccgcaa agagtcccgt ggagcccacc agcgccttga tgcaggttgt      1620
     acagagcgtg atgatgagaa tttcttgaaa catacgctgg cgttctataa cccagaaggt      1680
     gcaccacgtt tggagtacag tgatgtgaaa atcaccatat ctaaacccgc gaagcgggtc      1740
     tatggtggtg aagccgcagc acaagataaa caacagaagg agcaggcgaa tggctga         1797
//

If you have problems or comments...

PBIL Back to PBIL home page