(data stored in ACNUC1104 zone)

EMBL: FN667741.FRDB

FN667741.FRDB        Location/Qualifiers
FT   CDS_pept        complement(537851..538585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0106"
FT                   /gene="frdB"
FT                   /locus_tag="XBJ1_0536"
FT                   /product="fumarate reductase, anaerobic, Fe-S subunit"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79680"
FT                   /db_xref="GOA:D3UZ98"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79680.1"
FT                   /translation="MAEMKNLKMEVMRYNPEIDSEPHFVTYEVPYDEQTSLLDALGYIK
FT                   DNLAPDLSYRWSCRMAICGSCGMMVNRVPKLACKIFLRDYPQGMKIEALGNFPIERDLV
FT                   VDMTHFIESLEAIKPYIIGNDRKPADGPNVQTPAQMAKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAVTLAHRYNLDNRDHGKKERMPQINSDNGVWSCTFVGYCSEVCPKHVDPA
FT                   GAIQQSKAESAKDFLISMLKPQ"
     atggctgaga tgaaaaacct gaaaatggaa gtcatgcgct ataacccgga aatcgacagc        60
     gaacctcatt tcgtcaccta cgaggtgcct tatgatgagc aaacctcctt gctggatgcg       120
     ttaggctaca ttaaggacaa tctggctccc gatctgtctt accgctggtc ttgccgcatg       180
     gcgatctgcg gttcctgcgg catgatggta aaccgagtgc caaaactggc atgcaaaatc       240
     tttctgcgcg attatccgca agggatgaaa attgaagcgc tcggcaactt ccccattgaa       300
     cgagacttag ttgtcgatat gactcacttt attgagagtc tggaagctat caagccttat       360
     atcattggta atgatcgcaa gcctgctgat ggcccgaatg tgcaaacacc ggcacaaatg       420
     gcgaaatatc accagttttc aggctgcatc aactgcggcc tgtgctatgc cgcctgccca       480
     caattcggtc tgaatcctga attcattggc cctgccgcag tcacgctggc acaccgttat       540
     aaccttgata accgtgacca cggcaagaaa gaacggatgc ctcagatcaa cagtgacaat       600
     ggcgtgtggt cttgtacttt tgtcggttac tgctctgaag tttgcccaaa acacgtcgat       660
     ccggcgggtg caattcagca gagcaaagcg gaaagtgcca aagatttcct tatctccatg       720
     ctgaaaccac aatga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page