(data stored in ACNUC1104 zone)

EMBL: FN667741.FRDD

FN667741.FRDD        Location/Qualifiers
FT   CDS_pept        complement(537071..537424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0106"
FT                   /gene="frdD"
FT                   /locus_tag="XBJ1_0534"
FT                   /product="fumarate reductase, anaerobic, membrane anchor
FT                   polypeptide"
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79678"
FT                   /db_xref="GOA:D3UZ96"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZ96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79678.1"
FT                   /translation="MNQRPKRSDEPIFWGLFGAGGMWSAIVGPAMVLLLGFLIPLGLAP
FT                   EALSYDRVLTFCQSFIGRIFLLLMISLPLWCGMHRLHHGMHDLQIHIPASKGVFYGTAA
FT                   ILSVVALIGVFTL"
     atgaatcaac gacctaagcg ttccgatgaa ccgattttct ggggtctatt tggtgccggc        60
     ggtatgtgga gcgccattgt cgggccggcg atggttctgc tgctgggctt tctgatcccg       120
     ttgggactgg caccggaagc cctctcttat gatcgtgttc tgacattctg tcagagtttc       180
     attggccgca tctttttgtt gctgatgatc agcctgccgc tctggtgcgg aatgcaccgt       240
     ctgcaccacg gtatgcacga tctgcaaatc catattccag ctagtaaagg ggtgttttat       300
     ggtacagccg ctattttgag tgtggttgcc ttgattgggg tgtttacgct gtaa             354
//

If you have problems or comments...

PBIL Back to PBIL home page