(data stored in ACNUC1104 zone)

EMBL: FN667741.FTSE

FN667741.FTSE        Location/Qualifiers
FT   CDS_pept        557632..558297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0109"
FT                   /gene="ftsE"
FT                   /locus_tag="XBJ1_0554"
FT                   /product="putative transport protein (ABC superfamily,
FT                   atp_bind)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79698"
FT                   /db_xref="GOA:D3UZB6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79698.1"
FT                   /translation="MIRFEQVSKAYLGGRQALQGVDFHLLPGEMAFLTGHSGAGKSTLL
FT                   KLICGIERPSAGHIWFGGHDISRLKTRETPFLRRQIGMIFQDHHLLLDRTVYENVAMPL
FT                   IISGASAEDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIARAVVNKPTVLLADE
FT                   PTGNLDGELSEGIMRLFEEFNRVGVTVLMATHDVALIERRNYRILTLNQGRMQGGHHG"
     atgattcgct ttgaacaggt cagtaaagcc tatctgggag ggcggcaagc gctgcaaggg        60
     gtggattttc atctgcttcc aggggaaatg gcattcttaa ccggtcattc aggagcgggt       120
     aaaagcacgc tgttgaaact tatctgcggt atagaacgcc caagtgcagg ccatatttgg       180
     tttggggggc atgacatcag ccgattaaaa acccgtgaaa ccccttttct tcgtcgtcag       240
     atcggcatga tttttcagga tcatcatctc ctgctggatc gcacggttta cgagaacgtt       300
     gctatgccgc tgatcatctc aggggcaagc gccgaggata ttcgccgacg ggtatctgcg       360
     gcgttggata aggtaggctt gctggacaaa gcgaaaaatt ttcccattca gctttctggg       420
     ggggagcagc agcgtgttgg tattgcccgc gctgttgtaa acaaacccac cgtcctgctg       480
     gcggatgaac ccacaggaaa tctggatggg gaactgtctg aggggatcat gcgcctgttt       540
     gaagagttta accgcgttgg tgtgacggtt ctgatggcga cgcatgacgt agctctcata       600
     gaacgaagaa attaccgtat cctgacgttg aatcaggggc gtatgcaagg aggacatcat       660
     ggttaa                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page