(data stored in ACNUC1104 zone)

EMBL: FN667741.FTSX

FN667741.FTSX        Location/Qualifiers
FT   CDS_pept        558290..559270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0109"
FT                   /gene="ftsX"
FT                   /locus_tag="XBJ1_0555"
FT                   /product="integral membrane cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79699"
FT                   /db_xref="GOA:D3UZB7"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79699.1"
FT                   /translation="MVKNVRHSAKKMTPPKPKSKSLKGGWRVQQRYAWKSTLSDMLRQP
FT                   LATLLTIMVIAISLTLPSVFYIVWKNVNQAVEQWYPVPQLTVYLDKSLNDGGARQVIEQ
FT                   LKVIDGVKSVNYLSREEAENEFRAWSGFAGALNLLEENPLPAVAIISPQMDFQDSTVLT
FT                   TLRDRVSQIKGIEEVRMDESWFTRLTALANLIGQIAAVIGILMVVALLLVIGNSVRLSI
FT                   FSRRETINVMKLIGATDGFILRPFLNGGVLLGGLGAIFSLILSSLLVWKLSNVVTDVAG
FT                   VFGTTFKLYGLGWDESLLLVLISGMIGWLAAWFATIQHLRRFRPE"
     atggttaaaa atgtccgtca ttcagcgaaa aaaatgacac cgcctaaacc caagtccaag        60
     tcactgaaag ggggctggcg cgtacagcag cgttacgcgt ggaaaagcac cttgtcagat       120
     atgctgcgcc agccgctggc gacgttgctg actatcatgg taattgccat ctcattgacc       180
     ttaccgagcg tgttttacat tgtctggaaa aatgtcaacc aagcggtgga gcagtggtat       240
     cccgttccgc aacttacggt ctatctggat aaatccttga acgacggcgg cgccagacag       300
     gtgattgagc agttgaaagt cattgatggt gtgaaatcgg tgaattacct gtcccgtgaa       360
     gaagccgaga atgaatttcg tgcatggtct ggctttgccg gtgctttaaa tcttctggaa       420
     gaaaacccgc tacccgcggt cgcgattatt tcccctcaaa tggattttca agattcgacg       480
     gtattaacaa cattgcgtga tcgggtttcc cagatcaaag gtattgaaga agtcagaatg       540
     gatgagagct ggtttacccg cctcactgcc ttagcaaacc ttattggcca gattgctgct       600
     gtaataggta ttttgatggt ggttgcgctg cttttggtta ttggtaacag cgttcgtctc       660
     agtatcttta gtcgccgcga aactatcaat gtcatgaaac tgattggcgc aacagatggc       720
     tttattctgc gtcccttcct caatggtggc gtattgctgg ggggattagg cgcgattttt       780
     tctctgatcc tttcatcgtt actggtttgg aaactttcca atgtcgttac ggacgttgca       840
     ggtgtttttg gtactacctt taaattgtac ggtttgggat gggatgaatc cctgttgctg       900
     gtactgattt cgggcatgat aggctggctt gcggcatggt ttgcgactat tcagcattta       960
     cgccgtttca ggccggaatg a                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page