(data stored in ACNUC1104 zone)

EMBL: FN667741.FTSY

FN667741.FTSY        Location/Qualifiers
FT   CDS_pept        556228..557625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0109"
FT                   /gene="ftsY"
FT                   /locus_tag="XBJ1_0553"
FT                   /product="cell division protein: membrane binding
FT                   (N-terminal); GTPase domain (C-terminal)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79697"
FT                   /db_xref="GOA:D3UZB5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79697.1"
FT                   /translation="MAEEQKKGFFSWFGRGRQEKKQQEEQLEQDKSAAEEAEQQRLAEE
FT                   AARRAAEEAEQQRLAEEAARRAAEEAEQQRLAEEAARRAAEEAEQQRLAEEAARRAAEE
FT                   AEQQRLAEEAAHHAAEEAEQQRLAEEAARRAAEEAEQQRLIEESSILPKEQDRPSKEGF
FT                   FARLKRSLVKTRQNLGSGFLGLFSGKKIDDDLFEELEEQLLVADVGVETTRKIINNLTA
FT                   HASRKELKDAEALYTKLKEEMSDILAKVDKPLDIEGKSPYVILMVGVNGVGKTTTIGKL
FT                   ARQYQSQGKSVMLAAGDTFRAAAVEQLQVWGERNKIPVIAQHTGADPASVIFDAIQSAK
FT                   AKGVDILIADTAGRLQNKSHLMEELKKIVRVMRKLDEETPHEIMLTLDACTGQNAVSQA
FT                   KLFHEAVGLTGISLTKLDGTAKGGVIFAIADQFDIPIRYIGVGEGIEDLRPFKADDFIE
FT                   ALFARED"
     atggcagaag agcaaaaaaa aggtttcttc tcttggtttg gacgtggtcg tcaggaaaag        60
     aaacagcaag aagaacaact tgaacaagac aaatcagcgg cggaagaagc ggagcagcaa       120
     cgtttagccg aagaagccgc ccgtcgcgca gcggaagaag cggagcagca gcgtttagcc       180
     gaagaagccg cccgtcgcgc agcggaagaa gcggagcagc agcgtttagc cgaagaagcc       240
     gcccgtcgcg cagcggaaga agcagagcag cagcgtttag ccgaagaagc cgcccgtcgc       300
     gcagcggaag aagcagagca gcagcgttta gccgaagaag ccgcccacca cgcagcggaa       360
     gaagcggagc agcagcgttt agccgaagaa gccgcccgtc gcgcagcgga agaagcggag       420
     cagcagcgcc taatagaaga atcatccata ttacccaaag agcaggatcg tccgagcaaa       480
     gaaggctttt ttgcgcgttt gaaacgtagt ttggtgaaaa cccgccagaa tctgggttcc       540
     ggatttttag ggttattcag cggcaagaaa attgatgatg atctgtttga agaattggaa       600
     gaacagttac tggttgcgga tgttggtgtc gaaactaccc gtaagatcat taacaattta       660
     accgctcatg ccagccgcaa agaattaaaa gatgcggaag cgttatacac gaaactgaaa       720
     gaagaaatgt cagatattct ggcaaaagtt gataagccac tggatataga aggtaaatca       780
     ccttatgtca tcctgatggt gggtgtgaat ggtgttggta agacgacaac catcggtaaa       840
     ttggcgcgtc agtaccagtc tcagggcaaa tccgtcatgt tagcggcggg agataccttc       900
     cgtgcggcag cagtggaaca attgcaggtc tggggagaac gcaacaaaat cccggtaatt       960
     gcacagcata ccggcgcaga tccggcctca gtcatttttg atgcgatcca atctgccaaa      1020
     gcgaaaggcg ttgatattct gatcgctgat accgcagggc gcttgcagaa taaatcccat      1080
     ctgatggaag aactgaaaaa aattgtccgt gtgatgagaa agctggatga agagaccccg      1140
     catgaaatta tgctgactct ggatgcctgc acaggccaaa atgcggtcag tcaggctaaa      1200
     ctctttcatg aagcggttgg attgacgggg atctcactga ccaaactgga tggtactgcc      1260
     aaagggggag ttatcttcgc tattgccgac caatttgata tccctattcg ttacatcggt      1320
     gttggggaag gcattgaaga tctccgtcca tttaaggctg acgattttat agaggctctt      1380
     tttgcccgag aggattaa                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page