(data stored in ACNUC1104 zone)

EMBL: FN667741.GIDB

FN667741.GIDB        Location/Qualifiers
FT   CDS_pept        complement(33769..34389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0006"
FT                   /gene="gidB"
FT                   /locus_tag="XBJ1_0030"
FT                   /product="glucose-inhibited division protein, contains
FT                   S-adenosyl-L-methionine-dependent methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79185"
FT                   /db_xref="GOA:D3UY07"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79185.1"
FT                   /translation="MLNKLESLLVKTDIVLSLEQKQQLIAYVDMLNKWNKAYNLTSVRD
FT                   PEQMLVRHIMDSIVVNPFLHGTRFIDVGTGPGLPGIPLAIVRPDSHFTLLDSLGKRVRF
FT                   LRQVQHELGLKNIDPVQSRVEEFIPEPPFDGVISRAFASLQDMLSWCRHLPKPAEGRFY
FT                   ALKGVLPENELTQLPSGVTLDTVVSLQVPELGGERHLVVLKSN"
     ttgcttaaca aactggaatc gctgctggtg aaaacagaca ttgtgttatc gctagaacaa        60
     aaacaacagc ttatcgctta cgttgatatg cttaacaaat ggaacaaggc ttataacctg       120
     acatctgttc gtgatcccga acaaatgctg gttcggcata tcatggacag catagtcgtt       180
     aatccttttc ttcacggaac gcgatttatt gatgtgggaa cagggcctgg tttgccgggc       240
     atcccgttgg caattgtacg gccagattct catttcactc tgctggacag tttaggaaaa       300
     cgagttcgct tcttacgtca agttcagcat gaattgggtt tgaaaaacat tgatcctgtg       360
     cagagtcggg ttgaagaatt tatccctgaa cccccttttg atggggtgat cagccgtgca       420
     ttcgcttcgc tgcaagacat gctgtcatgg tgtcgtcatc ttcctaaacc agcagaaggc       480
     cgcttttatg ccctgaaagg cgtgctgccg gaaaatgagt tgacccaact gccttcagga       540
     gtaacgcttg atacggtggt ttctctgcag gttcctgagt tgggtgggga gcgtcatttg       600
     gtcgtactta agtcaaacta a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page