(data stored in ACNUC1104 zone)

EMBL: FN667741.GLNL

FN667741.GLNL        Location/Qualifiers
FT   CDS_pept        complement(204233..205279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0043"
FT                   /gene="glnL"
FT                   /locus_tag="XBJ1_0210"
FT                   /product="sensory kinase (soluble) in two-component
FT                   regulatory system with GlnG, nitrogen regulation (nitrogen
FT                   regulator II, NRII)"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79361"
FT                   /db_xref="GOA:D3UYI3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYI3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79361.1"
FT                   /translation="MMVDFPKAEHILDSLINSVLVLDNDLIIRYANHSAMQLLAQSTRK
FT                   LFGTPLPVLFSYLSLDTELMRSSLIRGHGFTDNEVILVINNHSHVMSLSAQPISEQFIL
FT                   LELAPMDSQRRLSQEQIQQAQQAAARELVRGLAHEIKNPLGGLRGAAQLLAKALPDPSL
FT                   REYTQVIIEQADRLRALVDRLLGPQHPGTRISQSIHYVVERVYQLVSLEMPANVTLIKD
FT                   YDPSLPELAHYPDQIEQVLLNMTRNALQALGEKGGTIILRTRTAFQITLHGERYRLVAR
FT                   IDIEDNGPGIPPNIQDTLFYPMVSGHEGGTGLGLSIARNLIDQHAGKIEFTSWPGHTEF
FT                   SIYLPIKK"
     atgatggttg attttcccaa agcagaacac atactcgact cactgattaa cagtgtcttg        60
     gtactggata acgatttgat tatccgctat gccaaccatt cagccatgca actactggca       120
     caaagtacgc gtaaattatt cggtactccc cttccggtgc tattcagcta tctctcactg       180
     gacacagaat tgatgcgttc cagtttgatt aggggtcatg gttttaccga taacgaagtg       240
     atattggtga tcaacaatca ctctcatgta atgtcgctca gtgcccaacc catttccgaa       300
     cagtttattc tgctggaact cgctcctatg gatagccagc gtcgtttaag ccaagagcag       360
     atacaacagg cacagcaggc ggctgcgcgg gaattggttc gggggctggc acatgaaata       420
     aaaaatcccc ttggaggact gcggggagcg gcgcaactgc ttgcaaaagc gttgcccgat       480
     ccctccctgc gggaatatac ccaagtgatt attgagcagg ctgacaggct gcgcgccctc       540
     gttgatcgat tgttgggtcc acagcatccg ggaacccgaa tcagccagag catccactat       600
     gttgttgaac gggtttatca gttggtatca ttggaaatgc ccgccaatgt cactttgatc       660
     aaagattatg atcccagcct gccagagctg gcgcattatc cagatcaaat tgagcaggtt       720
     ttactgaata tgacccgcaa tgcactacag gctctggggg aaaaaggtgg aacgatcatc       780
     ctgcgaaccc gaaccgcgtt ccaaattacc ttacatggtg aacgctatcg tctggtagcc       840
     agaattgata ttgaagacaa cggcccgggc attcctccca acattcagga tacgctattt       900
     tatcccatgg tcagtgggca tgaaggagga actggacttg ggttatccat cgcccgtaac       960
     cttatcgatc aacacgctgg caaaatcgaa ttcaccagtt ggccgggtca cacggaattt      1020
     tccatttacc tgcctatcaa gaaataa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page