(data stored in ACNUC1104 zone)

EMBL: FN667741.GLPG

FN667741.GLPG        Location/Qualifiers
FT   CDS_pept        complement(143471..144304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0028"
FT                   /gene="glpG"
FT                   /locus_tag="XBJ1_0141"
FT                   /product="putative membrane protein, member of glp regulon"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79292"
FT                   /db_xref="GOA:D3UYB4"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79292.1"
FT                   /translation="MIHVTSISNPRLAQAFIDYMVTQGIHLTMRPTHEPALVELWLEDE
FT                   NQLSFVEQELNQFSRDPFNERYQTASWQAGKSGYSFKYHNSLNLSTLKSQSGPLTISVT
FT                   ALCILVYLWMQVAGDSDVMRWLAWPNGEQYLELWRWVSPALLHFSLTHLLFNLALWWYL
FT                   GSQVERHMGAGKLFEITIVSAVFTDWAQSLFSGSHFGGLSGVVYALISYVWLTGEMSPK
FT                   RGISVPRGLIAISVIWLLVGYFDMFSLNIANAAHFSGLIIGLLMGLWDNLRKQKN"
     atgatccacg taacctcaat atccaatcca cgactggctc aagcctttat tgattatatg        60
     gtgacacagg gcattcactt gaccatgcgt cctacccatg agccagcact ggttgaattg       120
     tggctggaag atgaaaacca gttaagtttt gttgagcagg aacttaacca attttcccgc       180
     gatccattca atgagcgcta tcaaaccgcc agttggcaag ctggcaaatc gggttattca       240
     tttaaatatc acaacagcct gaatttgagc accttgaaaa gtcagtccgg cccgctgact       300
     atctccgtga ccgctctctg tatcttagtt tatctatgga tgcaggtggc aggagattcc       360
     gatgtcatgc gctggctagc gtggcctaat ggtgaacaat atctggaatt atggcgctgg       420
     gtcagccctg ccctgctgca tttctccctg acacatcttc tgttcaatct cgcgttatgg       480
     tggtatctcg gcagtcaggt ggaaaggcat atgggtgccg gaaaactctt tgaaattacg       540
     atagtctctg cggttttcac tgactgggca caatccttgt tcagtggatc gcattttggt       600
     gggctttctg gtgtggtcta cgcactgatc agctacgttt ggctgacggg tgaaatgtcc       660
     cccaaaagag ggatcagtgt ccccagaggg ttaatcgcta tctcggtcat ctggttattg       720
     gttggctatt tcgatatgtt ttcactgaat atcgccaatg ctgctcattt ttcggggtta       780
     atcatcggct tactcatggg gctatgggat aatttacgta aacaaaaaaa ttaa             834
//

If you have problems or comments...

PBIL Back to PBIL home page