(data stored in ACNUC1104 zone)

EMBL: FN667741.GLPT

FN667741.GLPT        Location/Qualifiers
FT   CDS_pept        complement(543953..545308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="XBJ1_0542"
FT                   /product="sn-glycerol-3-phosphate transport protein (MFS
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79686"
FT                   /db_xref="GOA:D3UZA4"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3UZA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79686.1"
FT                   /translation="MLSIFRPAPHKARLPAQEIDPLYRRFRWQIFMGIFFGYAAYYLVR
FT                   KNFGLAMPHLAEQGFSKGDLGFALSGISIAYGISKFIMGSVSDRSNPRIFLPAGLILAA
FT                   AVMLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSIWNC
FT                   AHNVGGGLPPLLFMLGMAWFQDWKAAFYMPAFAAILVAIIVFSLMRDTPQSCGLPPIEE
FT                   YKNDYPPDYTDKNEKELTAKEIFLQYILPNKLLWMIAIANVFVYLLRYGILDWSPTYLK
FT                   EVKHFAMDKSSWAYFLYEYAGIPGTLLCGWMSDKVFRGNRGATGVFFMTLVTIATIVFW
FT                   LNPAGNPNIDMICMLVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVA
FT                   ASIIVGYTVDFFGWDGGFMVMIGGSALSVVLLLFVMLSENKHKQEIARIASQ"
     atgttaagta tttttagacc ggcaccccac aaagcccggc tgcccgcgca agaaatagat        60
     ccactctacc gtcgctttcg ctggcaaatt ttcatgggga tcttctttgg gtatgcggct       120
     tactatttag taaggaaaaa ctttggattg gcaatgcctc acctagcgga acaaggtttt       180
     tccaaaggtg atcttggctt cgctttgtca gggatttcga ttgcatacgg tatctcaaaa       240
     tttatcatgg gttccgtttc tgatcgttcc aatccacgta ttttcttacc tgccggcttg       300
     atactcgccg cagcagtgat gctgtttatg ggtttcgtgc cgtgggcaac ttccagcatt       360
     gccgtcatgt ttgttctgct atttctgtgt ggctggtttc agggcatggg ttggcctccc       420
     tgcggccgta ctatggttca ttggtggtca cagaaagagc gtggtgggat cgtttctatc       480
     tggaactgtg cacataacgt tggtggcggc ttgcctccgt tactgttcat gctgggtatg       540
     gcgtggttcc aggactggaa agccgcattt tatatgcctg catttgccgc catccttgtc       600
     gcaattatcg tattttcctt gatgcgcgat actccacaat cctgtggttt accgccgata       660
     gaagagtata aaaacgatta tccgcctgac tatacggaca aaaatgaaaa ggaattgact       720
     gcaaaagaga tttttttgca atacattctg cctaacaaat tgctgtggat gatcgcaatt       780
     gccaacgtat tcgtttatct gctgcgctac ggtatcctcg actggtcacc aacctacctg       840
     aaagaagtaa agcactttgc tatggataaa tcgtcctggg cttacttcct ctacgaatat       900
     gcgggtattc ccggtacgct gctatgtgga tggatgtctg acaaagtgtt cagaggcaac       960
     cgtggtgcca ccggcgtatt ctttatgaca ctggtgacta tcgccaccat cgtattctgg      1020
     ttgaacccgg cgggtaaccc aaatattgat atgatctgta tgctggttat cggcttcctg      1080
     atttacggac cagtgatgct gattggcctg cacgctcttg aactggcacc gaaaaaagcg      1140
     gcgggaacag cggcaggctt taccggtttg tttggctacc tcggtggttc ggttgcggcc      1200
     agtatcattg tcggttatac cgttgacttc ttcggttggg acggcggatt tatggtcatg      1260
     atcggcggca gtgccctgtc cgtcgttcta ctgttgtttg tcatgttaag cgagaataaa      1320
     cataagcagg aaatcgctcg tatagctagc cagtaa                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page