(data stored in ACNUC1104 zone)

EMBL: FN667741.GLYS

FN667741.GLYS        Location/Qualifiers
FT   CDS_pept        246326..248395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0049"
FT                   /gene="glyS"
FT                   /locus_tag="XBJ1_0244"
FT                   /product="glycine tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79395"
FT                   /db_xref="GOA:D3UYL7"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYL7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79395.1"
FT                   /translation="MIQQTFLVEIGTEELPPKALRSLAESFAANFEAELKNANLGHGEI
FT                   SWFAAPRRLALKVANLAVAQADREVEKRGPAIAQAFDAEGKPTKAAEGWARGCGITVDQ
FT                   AERMVTDKGEWLLYRAQVKGREAKELLADMVSSSLGKLPIPKLMRWGDKETQFVRPVHT
FT                   VTMLLGSDVIDGEILGIKSDRIIRGHRFMGEAEFAIDNAEQYPTILQERGRVIADYYAR
FT                   KALIKRDAEQAAMQLGGVADLTDSLLEEVTSLVEWPVVLTAKFEEKFLEVPAEALVYTM
FT                   KGDQKYFPVYDKSGKLMANFIFVANIESSDPQQIISGNEKVVRPRLADAEFFFKTDRKQ
FT                   RLEDNLLRLETVLFQKQLGTLRDKTDRIQALAGWIAEKIGADVTHATRAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEAEDVALALNEQYQPRFSGDELPSTAVSCAVAIADKM
FT                   DTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKKLPLDLQTLAEEAVRLYGDKLTN
FT                   ENVVDDVVEFMLGRFRTWYQEQGYSVDAIQAVLARRPTQPADFDARMKAVTHFRTLDEA
FT                   VSLAAANKRVSNILAKSEEKLNDCVLASVLKAAEEIQLATHLVVLKDKLAPLFAEGNYQ
FT                   DALVELASLREVVDAFFDNVMVMDEDQQVRINRLTLLSELRELFLRVADISLLQ"
     atgattcaac agactttcct tgtggaaatc ggcacagaag agttgccacc aaaggcgctg        60
     cgctcgctgg ctgagtcctt tgcggccaat tttgaagcag aactgaaaaa cgccaatctg       120
     ggtcatggtg aaattagctg gtttgcagcc cctcgtcgtc tggcactgaa agtggcaaat       180
     ctggctgtgg cacaggctga tcgcgaagtg gaaaaacgtg gcccggctat tgctcaggca       240
     tttgatgcgg aaggcaagcc aactaaagcc gcggaaggct gggcgcgtgg ctgtggtatc       300
     acagttgatc aagccgagcg catggtaacg gataaaggcg aatggctgct ttatcgtgcg       360
     caggttaaag gccgtgaagc gaaagaactg ctggcggata tggtgagcag ttcgttgggc       420
     aagctaccga tccctaaact gatgcgctgg ggcgataaag aaacccagtt tgtccgccct       480
     gtgcatacgg tcacgatgct gctgggcagt gacgtgattg acggtgaaat tctgggcatc       540
     aaatctgatc gtattatccg tggtcatcgc tttatgggcg aggcggagtt tgcgattgat       600
     aatgcagagc aatacccgac gattttgcag gaacgtggcc gtgttattgc ggattattat       660
     gcacgtaaag cgttgatcaa acgtgatgca gagcaggcag cgatgcagct tggcggtgtg       720
     gcagatctga ccgacagcct gctggaagaa gtgacttctt tggtggaatg gccagtggtt       780
     ctgacagcga aattcgaaga gaaattcctt gaagtgcctg ccgaagcgct ggtttacacc       840
     atgaaaggcg atcagaaata tttcccggtt tacgataaat ccggcaaatt gatggcaaac       900
     tttatttttg ttgccaatat tgaatcgtct gatccacagc agatcatttc gggtaacgaa       960
     aaagtggtgc gcccacggtt ggcagatgcg gaattcttct ttaagactga ccgcaagcag      1020
     cgtttggaag ataatctgtt gcgtctggaa acggtactgt tccagaagca gctgggtaca      1080
     ctgcgtgaca aaacggatcg tattcaggct ctggctggct ggattgccga aaaaatcggt      1140
     gcagatgtca ctcatgcgac ccgcgcgggt ctgttgtcca aatgtgatct gatgaccaac      1200
     atggtatttg agttcacgga cactcagggc gtgatgggaa tgcactacgc tcgccatgat      1260
     ggtgaagcgg aagatgtggc tctggcactg aatgaacagt atcagccgcg tttctctggc      1320
     gatgagttgc catccacggc cgtttcctgt gctgtggcga ttgccgataa aatggatacc      1380
     cttgctggta tcttcggtat tggtcaacat ccgaaagggg ataaagatcc atttgcactg      1440
     cgtcgtgcgg cactgggtgt tctgcgtatt atcgttgaga aaaaactgcc gcttgatctc      1500
     cagaccttgg cagaagaagc cgtgcgtttg tatggtgaca aactgaccaa tgaaaacgtg      1560
     gtggatgatg tggttgagtt catgctcggc cgtttccgca cttggtatca ggagcagggt      1620
     tacagcgttg atgctattca ggcagtgctg gcgcgtcgtc cgactcaacc ggcagatttt      1680
     gatgcccgaa tgaaagcggt aacgcatttc cgcacactgg atgaagcggt ttcactggca      1740
     gccgctaata agcgtgtttc caacattctg gcgaagtcag aagagaagtt gaatgactgt      1800
     gttcttgctt ctgtattgaa agccgcagaa gagatccaac tggcgaccca tcttgtggtg      1860
     ttgaaagata agctggctcc tctgtttgcg gaaggcaact atcaggatgc gctggttgaa      1920
     ctggcttctc tgcgtgaagt ggtggatgcg ttcttcgaca acgtgatggt gatggatgaa      1980
     gatcaacaag tcagaattaa tcgcctgaca ctgttgagtg aattgcgtga gttgttcttg      2040
     cgcgtggcag atatttcatt gctccagtaa                                       2070
//

If you have problems or comments...

PBIL Back to PBIL home page