(data stored in ACNUC1104 zone)

EMBL: FN667741.GNTX

FN667741.GNTX        Location/Qualifiers
FT   CDS_pept        complement(145513..146196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0029"
FT                   /gene="gntX"
FT                   /locus_tag="XBJ1_0144"
FT                   /product="putative periplasmic gluconate-binding protein in
FT                   GNT I transport system"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79295"
FT                   /db_xref="GOA:D3UYB7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79295.1"
FT                   /translation="MLTMVGYCWLCHQSLYFAHHGICHICHQQLKRLKHVCPRCALPAE
FT                   SRDFPCGRCLKNPPPWQHLIAITDYAPPLSRLIRRYKYHGTPQLATVLARLFLLHWLQG
FT                   YRDGRWNKPDCILGIPLHSKKRWRRGFDQIELIAKPLSRWLQCHYQPDLLWRSRATLTQ
FT                   RGLSATQRKTNLKHAFQLRGDFTDQNVAIFDDVITTGTTLHEASQLLIRAGAHSVQAWA
FT                   ICRTL"
     atgctaacaa tggttggata ctgttggcta tgccatcaaa gtttgtattt tgctcatcat        60
     gggatctgcc atatctgcca ccagcaatta aaacggctga aacatgtctg tccgcgctgt       120
     gctctgcctg ccgaatcaag agattttccc tgtggccgct gcctgaaaaa tccgcccccg       180
     tggcaacacc tcatcgccat tacagactat gccccgccat taagccggct tatccgacgc       240
     tacaaatatc acggcacccc acaactcgcg acagtattag cccgtctgtt tctcctgcat       300
     tggttacagg gttatcgtga tggccgctgg aataagccgg attgtatact cggcattcct       360
     ctgcacagca aaaaacgctg gcgacgtgga ttcgatcaaa ttgaactgat cgccaagccg       420
     ttatcacgct ggttacaatg ccactatcag cccgatcttt tgtggcgctc gcgtgctaca       480
     ctcacacaac ggggcttatc tgccactcaa cggaaaacca atcttaagca tgcctttcaa       540
     ttgcgtggcg attttaccga tcaaaatgtc gcgattttcg atgatgtgat caccacgggg       600
     acaacgttgc atgaagcctc acagttgttg attcgtgcgg gtgctcactc cgtgcaagct       660
     tgggcaatat gccgaacctt gtag                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page