(data stored in ACNUC1104 zone)

EMBL: FN667741.GPH

FN667741.GPH         Location/Qualifiers
FT   CDS_pept        complement(61270..61974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0011"
FT                   /gene="gph"
FT                   /locus_tag="XBJ1_0053"
FT                   /product="phosphoglycolate phosphatase, contains a
FT                   phosphatase-like domain"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79204"
FT                   /db_xref="GOA:D3UY26"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79204.1"
FT                   /translation="MVTSIKKNLRAIAFDLDGTLVDSASGLAEALDQALIAKGLPPAGK
FT                   ERVAIWIGNGADVMVERALKWAGVESTPELHRETRKLFDGFYETTVTTGSQLFPYVKET
FT                   LATLAQHNLPMAIVTNKPTPFIAPLLESLGISEYFSLVLGGDDVKEKKPHPAPLYLTMG
FT                   MFGIHKEELLFVGDSRNDILAAQAAGCPCVGLTYGYNYGESIALSHPDYILDHFPDLLP
FT                   AIGLSTLKLQEA"
     atggtaacaa gtattaagaa aaatcttcgt gccattgcat ttgatctgga tggaacatta        60
     gtcgacagcg ccagcggtct ggcggaagca ctggatcagg ctctgattgc caaaggttta       120
     cctccggcag gcaaagaacg agttgctatc tggataggta acggcgcgga tgtcatggtt       180
     gaacgtgcac tgaaatgggc aggcgtagaa tccacccctg aattgcatcg tgaaacccgt       240
     aaactgtttg atgggtttta tgaaacaacc gtgacaacag gcagccaact gtttccctat       300
     gtaaaagaaa ctctggcaac actggcacag cataatctgc caatggccat cgtaaccaat       360
     aaacccacac cttttattgc gccattgctg gaatcattgg ggatcagtga atacttttca       420
     ctggtgctgg gtggtgatga tgttaaagag aaaaaacccc atcctgcccc gctatatcta       480
     acaatgggca tgtttggcat ccataaagaa gaattgcttt ttgtcggtga ttcccgtaat       540
     gatattttag cggcacaggc agctggctgc ccttgtgttg gcttaaccta tggatataac       600
     tacggagaat cgatagcatt aagccaccca gattatatat tggaccattt cccggattta       660
     ctaccggcta tcggattatc tacgttaaaa cttcaggaag cgtaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page