(data stored in ACNUC1104 zone)

EMBL: FN667741.HOLC

FN667741.HOLC        Location/Qualifiers
FT   CDS_pept        complement(448671..449135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0088"
FT                   /gene="holC"
FT                   /locus_tag="XBJ1_0445"
FT                   /product="DNA polymerase III, chi subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79595"
FT                   /db_xref="GOA:D3UW86"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:D3UW86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79595.1"
FT                   /translation="MKNATFYLLEKLSQEQLSSSDELQPHEWLACQLAADQWRAGKRVL
FT                   IACESQQQAEKLDEALWQREPSQFVPHNLAGEGPRYGAPVELCWPQKRSNAPRDILVTL
FT                   LPHFADFATAFHEVIDFVPIDENLKQLARERYKVYRSVSFNLTMATPPTY"
     atgaaaaacg ccaccttcta tttattggaa aagctctcac aggaacaatt atcgtcttct        60
     gatgaattac agccacatga atggctggca tgccagcttg ccgctgatca gtggcgggca       120
     gggaagcggg ttctgattgc ttgcgaaagc cagcagcagg ccgaaaaact ggacgaagca       180
     ctatggcagc gggagccaag tcaatttgta ccacacaacc ttgccggaga aggccctcgt       240
     tatggggctc ctgtggagtt gtgctggccg cagaaaagaa gcaatgctcc ccgcgatatt       300
     ctggtaacac tgcttcctca ctttgcagac tttgccacag ctttccatga agtgatagac       360
     ttcgtcccta ttgatgaaaa tctgaaacag ttagcgcgcg aacgatataa agtttatcgt       420
     agcgtcagct ttaatttgac catggcaaca ccgccaacct attaa                       465
//

If you have problems or comments...

PBIL Back to PBIL home page