(data stored in ACNUC1104 zone)

EMBL: FN667741.HSLO

FN667741.HSLO        Location/Qualifiers
FT   CDS_pept        77818..78690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0014"
FT                   /gene="hslO"
FT                   /locus_tag="XBJ1_0070"
FT                   /product="heat shock protein 33, redox regulated chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79221"
FT                   /db_xref="GOA:D3UY43"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79221.1"
FT                   /translation="MTKHDQLHRFLFESHSVRGELVSVSETYQRMMENHHYPLPVQQLL
FT                   GELLVATSLLTATLKFNGDITVQIQGDGPVRLAVINGNNQQQMRGTARIDGDVDAASSL
FT                   RDMVGNGYMVITVTPTEGERYQGVVALEGETLAECLDAYFKQSEQLPTRLFIRTGILDG
FT                   KMAAGGMLLQILPGAQEGSEDLLDHLVQLTATIKGEELFTLDVKEILHRLYHEEDVTLY
FT                   EPQQVEFRCTCSHQRCADTLVTLPDADLQEILLKDGKIDMECEFCGMHYIFNDKDISEI
FT                   KIVKKELLH"
     atgaccaagc atgatcaatt acaccgcttt ttgttcgaaa gccattctgt ccggggagaa        60
     ctcgtttccg tcagtgaaac gtaccagcgg atgatggaaa atcaccatta ccctttgccc       120
     gtacagcagt tattaggtga attgttggtc gcaaccagcc tgttgactgc cacattgaaa       180
     ttcaacggag atataaccgt acagattcaa ggtgatgggc cagtcagact ggcggtcatt       240
     aatggtaata atcaacagca gatgcgtggc actgcccgta ttgatggtga tgtggatgct       300
     gcgagcagcc tgcgggatat ggtcggtaat ggttatatgg ttattactgt tacgccaaca       360
     gaaggtgaac gttatcaggg cgttgtcgcg ctggaagggg agacgctggc agaatgtctg       420
     gatgcgtact tcaagcagtc ggaacaattg ccaaccagac tgtttatccg tacgggaata       480
     ctggatggaa aaatggcggc gggtggcatg ttattacaga tcctgcccgg cgcacaggaa       540
     ggcagtgaag acctgcttga tcatctggta caactcactg cgaccatcaa gggagaagag       600
     ctgtttacgc tggatgtgaa agaaattttg catcgtcttt atcatgaaga agatgtgacg       660
     ctgtatgagc cgcaacaggt tgaattccgc tgtacctgtt ctcaccaacg ctgtgctgat       720
     acgctggtga cgctgccgga tgctgatctt caggagattt tgctcaaaga tggcaaaatc       780
     gatatggaat gtgaattctg tggtatgcac tatattttca atgataaaga tatcagcgaa       840
     ataaagattg tgaaaaaaga actgcttcac tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page