(data stored in ACNUC1104 zone)

EMBL: FN667741.HSLR

FN667741.HSLR        Location/Qualifiers
FT   CDS_pept        77378..77791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0014"
FT                   /gene="hslR"
FT                   /locus_tag="XBJ1_0069"
FT                   /product="heat shock protein 15, DNA/RNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79220"
FT                   /db_xref="GOA:D3UY42"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79220.1"
FT                   /translation="MPNSDTDQTMRLDKWLWAARFYKTRSIAREMIDGGKVHYNGQRSK
FT                   PSKLVELNAEIKLRQGNEEKIVTVLALNSHRRSATEAQQLYQETEKSIINREKTALARK
FT                   MNVLTMPHPDRRPDKKERRTLIKFKNTKLNEPE"
     atgccgaatt cagacacgga tcagactatg cgcctcgata aatggctctg ggctgcccgt        60
     ttttacaaaa cccgctccat cgcgcgtgaa atgattgatg ggggaaaagt tcattataat       120
     gggcagcgga gtaaaccgag taaactggtt gagttgaatg cagaaattaa actgcgtcag       180
     ggaaatgaag agaaaatagt gactgtttta gcattgaaca gtcacagacg cagcgccact       240
     gaagcccagc aactttatca ggaaacggaa aaaagcatta tcaatcggga aaaaacggca       300
     ttggcccgta aaatgaatgt gctcacgatg ccgcatcccg atcgccgccc agataagaaa       360
     gagcggcgta cactgattaa atttaagaac acgaaattaa acgagccgga ataa             414
//

If you have problems or comments...

PBIL Back to PBIL home page