(data stored in ACNUC1104 zone)

EMBL: FN667741.HSRA

FN667741.HSRA        Location/Qualifiers
FT   CDS_pept        complement(47940..49322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsrA"
FT                   /locus_tag="XBJ1_0043"
FT                   /product="putative transport protein (MFS family)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79198"
FT                   /db_xref="GOA:D3UY20"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79198.1"
FT                   /translation="MVKSARSMSGLPWIAAIAFFMQSLDATILNTALPAIAKSLNHHPL
FT                   AMQPAIVSYTLTVAMLIPVSGWLADRFGTQRIFIYAVSLFSLGSLACALSSSFSFLVAA
FT                   RVIQGIGGAMMMPVARLALLRAYPRSELLPVLNFVTMPGLLGPILGPMLGGLLVTYATW
FT                   HWIFIINIPIGLLGIIYAKKHMPNFTMPKCFFDFLGFMLFSVGLVMLSVSFDLFGNNTL
FT                   PNYVPVAVMAGSIIMLSGYIFHAKRHPNPLIDLQLFQTRTFSVGITSNIATRLSTGSLS
FT                   FLIPLMLQVGFGYSAVIAGIMMAPNAIGAILAKSFVTKLLTQFGYRNTLIWVTVIIGVM
FT                   IAQFSLQTPEISLVFLIIPLFVLGMAMSTQFTSMNTITLGDLNNNNASAGNSLLAVTQQ
FT                   LSISLGVTVSAAILRFYESAEYGSTVDHFHYTFITIGVITLASSFVFLLLKKEDGRNLI
FT                   KK"
     atggtcaaat ctgcacgcag tatgtcggga ctgccctgga ttgctgcgat agcttttttt        60
     atgcaatccc tggatgcaac catccttaat accgcattgc cggcaattgc taaaagtctt       120
     aatcatcatc ctctggcaat gcagccagcc attgttagtt ataccttaac ggtggcaatg       180
     ttaatcccgg tcagtggttg gttggctgat agattcggca cacaacggat attcatttat       240
     gccgtttccc ttttttcttt aggttcactc gcctgtgcgt tatccagcag tttctctttt       300
     ttggtagctg cccgcgtcat tcaagggatc ggtggtgcca tgatgatgcc tgttgcccgt       360
     ttggcattac tgcgggcata tcctcgcagc gaattgttgc ccgttttgaa ttttgtgact       420
     atgccaggtt tgcttggccc aattttaggc cccatgctcg gcggactgtt agtaacttat       480
     gcaacttggc attggatctt catcatcaat attcctatcg gcctactggg tattatttat       540
     gccaaaaagc acatgcccaa ctttaccatg cctaaatgct tctttgattt tctgggattc       600
     atgctattta gtgtaggact ggtgatgctt tcggtcagct ttgatttatt tggtaataat       660
     actctaccta actatgttcc cgttgcggtt atggcgggta gtatcattat gctgtcagga       720
     tatatttttc atgcaaaaag gcacccaaat ccactcatcg acctccagtt gttccaaaca       780
     cgtacctttt cagttggtat caccagcaat attgccactc gcttaagtac aggatccctc       840
     tcatttctta ttccgttaat gctacaagtg ggttttggtt attcggcggt tattgccggg       900
     ataatgatgg caccaaacgc cattggcgca attctcgcta aatcttttgt caccaaatta       960
     ctgactcaat ttggatatcg aaacacgctc atttgggtta cggtgatcat tggtgtgatg      1020
     attgcacagt tttcactaca gacaccggag atatcactcg tctttttgat cattcctcta      1080
     tttgttttag gaatggcaat gtccacgcaa tttacatcaa tgaataccat tacccttggt      1140
     gatttgaata ataacaatgc cagtgcgggc aatagcctat tggcggttac tcaacagtta      1200
     tctatcagtt taggagtaac agtcagtgct gcaatccttc ggttttacga atcagcggaa      1260
     tacggttcaa cagtggatca cttccactat acctttatta cgataggcgt gattactcta      1320
     gcctcttctt ttgttttcct gttattgaag aaagaagatg gccggaattt gatcaaaaag      1380
     taa                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page