(data stored in ACNUC1104 zone)

EMBL: FN667741.METI

FN667741.METI        Location/Qualifiers
FT   CDS_pept        complement(634303..634956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0122"
FT                   /gene="metI"
FT                   /locus_tag="XBJ1_0614"
FT                   /product="D-and L-methionine transport protein (ABC
FT                   superfamily, membrane)"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0614"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79758"
FT                   /db_xref="GOA:D3UWI4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3UWI4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79758.1"
FT                   /translation="MSDGMIFLLFKGVWETLVMTFVSGFFGFVIGLPIGVLLYVTRAGQ
FT                   IMENITLYRILSALVNIGRSIPFIILLVWMIPFTRLIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPPGLIEAARAMGATPLQIVKKILLPEAQLSLINAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNAPVMNTVLALLIVLVFLIQLGGDRLIIAVNHK"
     atgtctgatg gaatgatttt cttattgttt aaaggagtct gggaaacttt agtaatgact        60
     tttgtttcag gtttttttgg ttttgtaatt ggtttaccaa tcggtgtgct tttatatgtc       120
     acccgtgcag gacagattat ggagaatatt acactttatc gtattctttc cgccttagtg       180
     aatatcggtc gttcaattcc cttcattatt ttgttggtat ggatgatccc gtttacccgg       240
     ctaattgtcg gtacatccat tggcttgcaa gcggcgattg tccctctgac tgtgggagca       300
     gcacctttta ttgcccgcat ggtggaaaat gccttattgg aaattccgcc tggattgatc       360
     gaagctgcac gtgcgatggg tgcaacgcct ttacagattg tcaaaaaaat cctgcttcct       420
     gaagcccagt tgagtttaat aaatgctgca acgattactt tgattacttt ggtcggctat       480
     tccgcaatgg gaggtgccgt tggcgcaggt ggcttaggcc agattggtta tcaatatggt       540
     tacattggct acaatgcacc tgttatgaat actgttttag cattgttgat tgttttagtg       600
     ttcttaattc agttaggcgg tgatcgcttg attatagcag ttaatcacaa ataa             654
//

If you have problems or comments...

PBIL Back to PBIL home page