(data stored in ACNUC1104 zone)

EMBL: FN667741.MIOC

FN667741.MIOC        Location/Qualifiers
FT   CDS_pept        complement(36666..37106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0007"
FT                   /gene="mioC"
FT                   /locus_tag="XBJ1_0032"
FT                   /product="FMN-binding protein, required for biotin synthase
FT                   activity"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79187"
FT                   /db_xref="GOA:D3UY09"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79187.1"
FT                   /translation="MSTITLISGSTMGSSEYVAEHMAEILENHGFSTEVLHGPSLDDLR
FT                   LGGLWLVVTSTHGAGDLPENLQPLADTIAQQQPDLSNVTFGAVGIGSSEYDIFCGAIKS
FT                   FEHLLKDRGAKRIGDRLEIDIQKYEIPEDPAEDWVKEWAKLL"
     atgagcacaa taaccttaat cagcggcagc acaatgggaa gttctgaata tgttgccgaa        60
     catatggcgg agatcttaga aaatcacggg ttttcaactg aggtccttca tggtccttca       120
     ttagatgatc tgcgccttgg tgggctatgg cttgtggtca catcaacgca tggagcaggg       180
     gacttacccg aaaatcttca gcctctggca gacacgatcg cacaacaaca gccagatcta       240
     agtaacgtga catttggagc ggtcggtatt ggcagttcag aatatgacat attctgtggt       300
     gcaatcaaat catttgagca cctattgaaa gatcgcggag caaaaaggat cggggatcga       360
     ttggaaatag acatccagaa gtatgaaatc cccgaggatc ccgctgaaga ttgggttaaa       420
     gaatgggcaa agttactctg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page