(data stored in ACNUC1104 zone)

EMBL: FN667741.MSRA

FN667741.MSRA        Location/Qualifiers
FT   CDS_pept        complement(347036..347683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="XBJ1_0340"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79490"
FT                   /db_xref="GOA:D3UYW2"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYW2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79490.1"
FT                   /translation="MPNSANESQHVSTQDALLGRAIPLTVSPYHVITQHSINDIPENME
FT                   IAYIGMGCFWGVERLFWQQEGIYTTSVGYSGGTTPNPTYEEVCTGLTGHAEVVRIVFDP
FT                   TKITYGQLLTLFWENHDPAQGMRQHGDIGTQYRSAIYTISSQQYEQALATREQFQQAMN
FT                   ENGDQRTITTEIHAAKPFYFAEDYHQQYLFKNPEGYCGLGGIGVCLLPTHKN"
     ttgccaaatt cagccaacga aagccaacat gtttccacac aggatgcatt actgggtagg        60
     gcaatcccat taactgtatc accctaccat gtcatcacac agcattcgat aaacgacatt       120
     cctgaaaaca tggagatagc ctatatagga atggggtgtt tctggggagt tgagcgcctg       180
     ttctggcaac aggaaggtat ctacacgacc tctgtgggtt acagtggtgg tactacgcca       240
     aatccaactt atgaagaagt ctgcacaggg ttaaccggac atgccgaagt agtcaggatc       300
     gtatttgatc caaccaaaat cacttatggg cagttattga cgcttttctg ggaaaatcac       360
     gatcccgccc aaggtatgcg tcaacatggt gatatcggta cacagtaccg ctctgccatt       420
     tatactattt catctcaaca atatgagcag gcactcgcta cccgcgaaca attccagcaa       480
     gcgatgaatg aaaatggcga ccagcgcaca atcaccacgg agatccacgc agcgaagcca       540
     ttctattttg cggaagatta tcaccagcag tatctcttca aaaatcctga agggtattgt       600
     ggactcggtg gtattggggt atgcctcctc cctacgcaca aaaactag                    648
//

If you have problems or comments...

PBIL Back to PBIL home page