(data stored in ACNUC1104 zone)

EMBL: FN667741.MUTL

FN667741.MUTL        Location/Qualifiers
FT   CDS_pept        328219..330162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0064"
FT                   /gene="mutL"
FT                   /locus_tag="XBJ1_0319"
FT                   /product="enzyme in methyl-directed mismatch repair,
FT                   stimulates binding of Vsr and MutS to heteroduplex DNA"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79469"
FT                   /db_xref="GOA:D3UYU1"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYU1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79469.1"
FT                   /translation="MAIRILPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIE
FT                   IERGGAKLIRIRDNGCGIDQQDLTLALARHATSKIASLDDLEAIVSMGFRGEALASISS
FT                   VSRLTLTSRTESQTEAWQAYAEGRDMEVTVKPAAHPVGTTVEVLDLFYNTPARRKFLRT
FT                   EKTEFGHLDEVVRRIALARLDVAINLHHNGKLVRQYRPAKEESQHERRLAAICGMAFVQ
FT                   QALALSWQHDSLSIKGWVADPMSDTVGGDIQYCYVNGRMMRDRLINHAIRQAYQDLLQG
FT                   EKQPAYVLYLEIDPHQVDVNVHPAKHEVRFHQARLVHDFIYQGVAAVLKQRGKGAELAL
FT                   GCEEPAASWVPENRLSAGENHFLQQNTASLKASPPSRAAAAPSVSSGGHDKEQPQLDRP
FT                   HSGNDTRQLHHGENYQKKQGELYQKMMQSAPEEKRPLFPERAVSVREKAAPIPVGAALL
FT                   QGKNISYSFGKVLSIHAASYALIESPLGIGLLSLPVAERWLKQVQLTPGELGLKSQPLL
FT                   IPLKLSLSQAEIDALKQNSELLKTFGIESTVAHGKVTIHAVSLPLRQQNLPKLLPELLN
FT                   YLVEQPSACAEQVAIWLSRHVGSEHETWNIAQAVQLLADVERLCPQLVESPPEGLLQLI
FT                   DLQAVVALLNHE"
     atggctatca ggattttacc cccacaatta gcaaatcaga ttgctgctgg tgaagtggtt        60
     gagcgccctg catcggtggt gaaagaattg gtggaaaaca gccttgatgc cggcgctacc       120
     cgcattgata ttgagattga acgcggtggc gcgaaattaa tccgcattcg tgataacggc       180
     tgtgggatag accagcagga tctgacatta gcactggcac gtcatgccac cagtaaaatc       240
     gcttcgcttg atgatttgga ggcgattgtc agtatgggat tccgtgggga agcactggcc       300
     agtatcagct cggtttcacg attgactctg acttcccgta ctgaaagcca gacagaagcg       360
     tggcaggctt acgccgaagg ccgtgatatg gaagtcaccg taaaacccgc agctcatccc       420
     gtcggtacga cggttgaagt attggatctg ttttataata cgccagcacg tcgcaaattc       480
     ctgagaacag aaaaaaccga attcgggcat cttgatgaag tggtgcgcag gatagctctg       540
     gcacggttgg atgtggcgat caacctgcat cacaacggca aattggttcg tcagtatcgt       600
     ccagcgaaag aagaatctca gcatgagcga cgtttggcgg ccatttgcgg aatggcgttt       660
     gtgcagcagg ctcttgcgct gtcgtggcag catgattcct tgtctattaa aggatgggtt       720
     gctgatccca tgagtgatac tgtcgggggc gatattcagt attgttatgt caatggacgt       780
     atgatgcggg atcggctgat taatcatgct atccgtcagg cctatcaaga tttgcttcag       840
     ggagagaagc agcctgctta tgtattgtat ctggagattg atccgcatca ggttgatgtc       900
     aatgtgcatc cagcgaagca tgaggtacgc ttccatcagg cacgtctggt acatgatttt       960
     atttatcagg gtgtggcagc agtattgaaa caaaggggga aaggagctga actggcgctt      1020
     ggttgtgagg agccggctgc cagttgggtg ccggaaaacc gtctttctgc gggagagaac      1080
     cattttctcc agcaaaatac ggcttcactg aaggcatcac cgccttcccg cgccgcggct      1140
     gccccctcgg tttcatctgg agggcatgac aaagaacagc ctcagcttga tcgcccgcat      1200
     tctggcaatg atacgcggca acttcatcat ggggaaaatt accagaagaa acagggcgag      1260
     ttgtaccaga aaatgatgca atctgcacca gaggagaaac ggccgctgtt tcctgaaaga      1320
     gctgtctccg tgagggaaaa agccgctccg attcctgttg gtgccgcact tttgcaggga      1380
     aaaaacatta gttacagttt tggcaaggta ttgagcatcc atgctgccag ttatgccttg      1440
     attgagtctc cgttggggat tgggctactg tctttgccag ttgctgaacg ctggctgaaa      1500
     caggtgcagt tgacgccagg ggagctgggg cttaaatcgc agccgctact gatcccgctg      1560
     aaactgtctc tcagtcaggc agaaatcgac gctttaaagc agaatagtga gctattgaag      1620
     actttcggta ttgaatctac agtcgcacat ggaaaagtaa ctattcatgc ggtatcgttg      1680
     ccactgcgtc aacagaacct gccgaaactc ctgccggagc tgttgaacta tctagtggaa      1740
     caaccctcgg cctgtgctga acaggtagcg atttggctct cccgtcacgt tgggagcgaa      1800
     catgaaacgt ggaacattgc gcaagccgtc cagcttttag ctgacgtcga gcgtctttgc      1860
     cctcaattgg tggaatcccc gccagagggc ttattacagt taattgattt acaagcagtg      1920
     gtggcacttc tcaatcatga gtga                                             1944
//

If you have problems or comments...

PBIL Back to PBIL home page