(data stored in ACNUC1104 zone)

EMBL: FN667741.OBGE

FN667741.OBGE        Location/Qualifiers
FT   CDS_pept        362639..363817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0071"
FT                   /gene="obgE"
FT                   /locus_tag="XBJ1_0357"
FT                   /product="putative GTP-binding protein with nucleoside triP
FT                   hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79507"
FT                   /db_xref="GOA:D3UYX9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:D3UYX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79507.1"
FT                   /translation="MKFVDEASILVVAGDGGNGCVSFRREKYIPKGGPDGGDGGDGGDV
FT                   YLLADENLNTLIDYRFEKSFRAERGQNGQSRGCTGRRGQDITIKVPVGTRVRDIATGEV
FT                   LADMVRHEQRQMVAKGGFHGLGNTRFKSSVNRAPRQKTMGTPGESRELMLELMLLADVG
FT                   MLGMPNAGKSTFIRSVSAAKPKVADYPFTTLVPSLGVVRMDNEQSFVVADIPGLIEGAS
FT                   EGVGLGIRFLKHLERCRVLLHLIDLCPLDESDPVENARIIIKELHKYSEKLAEKPRWLV
FT                   FNKVDLTDPEEAKQRAKAIADELGWEGDYYMISAVNRQGVKELCWDIMEFMKAQPRHMD
FT                   VEAEAQPEKVEFMWDDYHKEQLQQSSDADVDDDLDDDWDEGDEEGIEFIYKH"
     atgaaatttg tagatgaagc cagcatactg gttgtagcgg gagatggtgg caatggttgt        60
     gtcagcttcc gtcgagaaaa atatattcca aaaggtgggc cagacggcgg tgatggtggt       120
     gacggcggtg atgtttatct gctggcagat gaaaatctca atacgctgat tgactaccgc       180
     tttgaaaaat ccttccgtgc tgaacgtggt caaaacggac aaagccgtgg ttgtaccggt       240
     agacgtggcc aagacattac catcaaagtc ccagtaggaa cccgtgtgcg cgatatcgcg       300
     actggggaag tccttgcgga tatggtgcgt catgagcagc gtcagatggt tgctaaaggg       360
     gggttccacg gtcttggtaa tacccgcttt aaatcttctg ttaaccgtgc tccccgccaa       420
     aaaactatgg ggacgccagg tgaaagccgt gagctgatgc tggagctgat gctgctggca       480
     gacgtgggaa tgctggggat gcctaatgca ggtaaatcca ccttcattcg ctctgtttcg       540
     gcggcgaaac ctaaagtggc ggattaccca ttcacgacac tggtgccaag tcttggcgtc       600
     gtgcggatgg ataacgagca aagctttgta gtggcagata ttcccggttt gatcgagggt       660
     gcgtcagaag gtgtgggttt gggtattcgt ttcctgaaac atttggaacg ttgtcgtgtc       720
     ttacttcact taattgatct ctgcccgctc gatgaatctg atccggttga aaatgcccgt       780
     atcattatca aagaactgca taaatacagc gaaaaactgg cagaaaaacc gcgttggctg       840
     gtattcaata aagtcgatct gaccgatccg gaagaagcta aacagcgggc aaaagccatt       900
     gctgatgagc ttggctggga aggtgattat tacatgattt cagctgtaaa tcgtcagggt       960
     gtgaaagagc tttgctggga catcatggaa ttcatgaaag ctcagcctcg ccatatggac      1020
     gtggaggcag aagcccagcc ggaaaaagtt gaattcatgt gggatgatta ccataaggaa      1080
     cagttacaac aatcatctga tgcggatgtt gacgatgatt tggatgatga ctgggatgag      1140
     ggagacgaag aaggcataga gtttatttat aaacactag                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page