(data stored in ACNUC1104 zone)

EMBL: FN667741.PAAB

FN667741.PAAB        Location/Qualifiers
FT   CDS_pept        complement(128434..128721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaB"
FT                   /locus_tag="XBJ1_0126"
FT                   /product="putative subunit of multicomponent oxygenase,
FT                   phenylacetic acid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79277"
FT                   /db_xref="InterPro:IPR009359"
FT                   /db_xref="InterPro:IPR038693"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79277.1"
FT                   /translation="MSDTDWPLYEVFIRSKQGLAHRHVGSLHAADDQMALENARDVYTR
FT                   RNEGCSIWVVKSIHLVASQPEERGAFFDPSEDKIYRHPTFYTIPDGIKNM"
     atgagtgata ccgattggcc gctgtatgaa gtctttatcc gcagcaaaca ggggctggct        60
     caccgtcatg tcggcagcct ccatgcagca gatgatcaaa tggcgctgga gaacgcgcgc       120
     gatgtctaca ctcgccgcaa tgaaggttgc tccatctggg tagtgaaatc tatccatctg       180
     gtggcatcac aacctgaaga gcgcggggct tttttcgatc cctcggaaga caaaatctac       240
     cgtcatccga ctttctatac cattcctgat ggcatcaaga atatgtaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page