(data stored in ACNUC1104 zone)

EMBL: FN667741.PAAC

FN667741.PAAC        Location/Qualifiers
FT   CDS_pept        complement(127647..128423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaC"
FT                   /locus_tag="XBJ1_0125"
FT                   /product="putative subunit of multicomponent oxygenase,
FT                   phenylacetic acid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79276"
FT                   /db_xref="GOA:D3UY98"
FT                   /db_xref="InterPro:IPR007814"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011882"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79276.1"
FT                   /translation="MNTHSVDPSNHDLLNYVLRQGDTPLILAQRLCEWCGHAPELEIDL
FT                   ALSNIGLDLLGQARHFLSYAATLYGMDFDEDRLAFGRDEREYRNLLLVEQPNGGFNDTL
FT                   VRQFFIDAYHVLLHQALGQSRDPQLAAISTKSLKEVEYHLRFSRGWMIRLGDGTELSRE
FT                   KIRQSVNQLWRFTGELFYCDEVEQRLAEEGIAVDPRTLYEPWRQIINETFAQATLEIPQ
FT                   ETPYRQGGKQGLHTEHLGYMLAEMQYLQRTYPNCNW"
     atgaatacac atagcgttga tccatccaac catgacctgc ttaattatgt gctacggcag        60
     ggggataccc cgttaattct ggcacagcgc ctgtgtgaat ggtgcggcca tgcgccagaa       120
     ctggaaattg accttgccct gtcgaatatc ggcctcgatc tgctggggca ggcgcgccat       180
     tttctcagct acgccgccac actctacgga atggattttg atgaagatcg gctggcattt       240
     ggccgcgatg aacgagaata ccgcaatctg ctgctggtag agcaacccaa cggcggcttt       300
     aacgatacgc tggtacgtca gttttttatc gatgcttatc acgtcctgct ccatcaggca       360
     ctggggcaga gccgcgatcc tcaattggcc gctatcagca ccaaatcgtt gaaagaagtc       420
     gaatatcacc tgcgtttcag ccgtggctgg atgatccggc tgggggatgg tacggaactg       480
     agccgcgaaa aaatccggca atcggtcaat caactgtggc gctttaccgg cgaactgttc       540
     tattgcgatg aagtggaaca gcggctggcc gaagaaggca ttgcggtcga tccccgtacc       600
     ttgtacgaac cctggcggca aattatcaac gagacattcg cccaagccac attggaaatt       660
     ccgcaggaaa cgccctaccg acagggaggc aagcagggac tgcataccga acatctggga       720
     tacatgctgg cggaaatgca gtatctgcaa cgcacttatc ccaactgtaa ctggtaa          777
//

If you have problems or comments...

PBIL Back to PBIL home page