(data stored in ACNUC1104 zone)

EMBL: FN667741.PAAD

FN667741.PAAD        Location/Qualifiers
FT   CDS_pept        complement(127108..127617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaD"
FT                   /locus_tag="XBJ1_0124"
FT                   /product="putative subunit of multicomponent oxygenase,
FT                   phenylacetic acid degradation"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79275"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR011883"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79275.1"
FT                   /translation="MEQHVNTLQLQNPAIHQIWQCLHQIADPELPVLSITDLGMVRAVT
FT                   PQLTGWRVTFTPTYSGCPATEYLINEIQQTLARAGFTSVTVEISLRPAWTTDWMNADAK
FT                   QRLREFGIAPPQGLACEKPTETETITCPRCGSHETEKISEFGSTACKAIYRCQQCLEPF
FT                   DYFKCI"
     atggaacaac acgttaacac attacaatta cagaatccgg ccatccatca gatctggcaa        60
     tgcctacacc agattgccga tcctgagctt cccgtactct ccattactga tctcggtatg       120
     gttcgggcgg tgacccccca gctaaccggc tggcgggtga cattcacccc gacgtactcc       180
     ggttgtccgg caacggaata cctgatcaat gagattcagc aaacactggc acgggcgggc       240
     tttacatcgg tcactgtcga aatcagcctg aggccggcat ggacaactga ctggatgaat       300
     gccgatgcca aacaacgcct gcgggaattc ggtatcgcgc ctccacaagg tctggcttgt       360
     gaaaaaccga cagaaacaga aacaatcacc tgcccacgtt gtggtagcca tgagaccgaa       420
     aaaatcagtg aattcggttc caccgcctgc aaagcgatct atcgctgtca gcagtgtctg       480
     gaacccttcg actatttcaa atgtatttga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page