(data stored in ACNUC1104 zone)

EMBL: FN667741.PAAE

FN667741.PAAE        Location/Qualifiers
FT   CDS_pept        complement(126003..127088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaE"
FT                   /locus_tag="XBJ1_0123"
FT                   /product="putative phenylacetic acid degradation protein
FT                   with NADP-linked, 2Fe-2S ferredoxin-like and riboflavin
FT                   synthase-like domains"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79274"
FT                   /db_xref="GOA:D3UY96"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR011884"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79274.1"
FT                   /translation="MATFHRPTFHRLSIAAIERETPDAVTVTLHVPDELKALFCYQPGQ
FT                   HLTLKARVDGAELRRCYSICSSPLDDGLQIGVKATYQGRFSTFINQRLKVGDELDVMQP
FT                   QGNFGHHPDGNNAGNYLAIAAGSGITPILSIIKSTLALEPDSTFTLIYGNRTSRSVMFK
FT                   EALADLKNRYLHRFQVLYLFSQEITDSPMFNGRIDSEHLQHLGKILLNFSQFGQAFLCG
FT                   PAAMLDDAKSALEQAGMASERIHTERFNTGRNPSSTAARPANLAERSETRVEIHLDGRT
FT                   LNIAMNTEDDSILDAALRQGADLPYACKGGVCATCKCRLKSGEVDMNVNYSLEPDQLAA
FT                   GYILSCQSWPKGDGVVVDFDV"
     atggctactt ttcatcgtcc gacttttcac cgcttaagca ttgcagcgat tgagcgggaa        60
     acacctgatg ccgtgaccgt cacactgcat gtccccgatg agttgaaagc cctcttttgc       120
     tatcaacccg gccagcacct gacacttaag gcgcgggtgg atggtgcaga gctacgccgc       180
     tgttactcca tttgcagttc accactggac gatggattac aaattggcgt caaggccacc       240
     tatcaagggc gtttttcgac tttcatcaac cagcggctta aagtcgggga tgagctggat       300
     gtcatgcaac cacaaggcaa tttcggccac catcccgatg ggaacaacgc gggaaactat       360
     ctggcaatcg ctgcgggttc gggtatcacg ccaattctat cgatcatcaa aagtacactg       420
     gcgctggaac cggatagcac cttcacgctg atttacggta accgcaccag ccgttccgtg       480
     atgttcaaag aagcgctggc cgatctgaaa aatcgctacc tgcaccgttt tcaggtgctg       540
     tacctcttca gtcaggaaat caccgatagc ccgatgttca acggccgcat tgatagcgag       600
     caccttcaac acctcggcaa aatcctgctc aatttcagcc agttcggaca ggcctttctc       660
     tgcgggccag cagccatgct ggatgatgcc aaatctgcac ttgagcaggc cggcatggcg       720
     tccgaacgta tccatacaga acgcttcaac accgggcgta atccatcaag taccgctgcc       780
     cgcccggcca atctggccga acgcagtgaa acccgtgtgg agattcatct ggatggccgc       840
     accctgaaca ttgccatgaa caccgaagat gacagcattc ttgatgcagc actacgtcaa       900
     ggtgccgatt taccctatgc ctgtaaagga ggcgtgtgtg ccacctgcaa atgccgtctc       960
     aaatccggtg aagtggacat gaacgtaaac tacagccttg agccggatca attggctgcc      1020
     ggttatatct taagctgcca gtcgtggccg aaaggtgacg gcgtggttgt ggattttgac      1080
     gtctag                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page