(data stored in ACNUC1104 zone)

EMBL: FN667741.PAAI

FN667741.PAAI        Location/Qualifiers
FT   CDS_pept        complement(122340..122807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="XBJ1_operon0025"
FT                   /gene="paaI"
FT                   /locus_tag="XBJ1_0119"
FT                   /product="putative phenylacetic acid degradation protein
FT                   with thioesterase/thiol ester dehydrase-isomerase domain"
FT                   /db_xref="EnsemblGenomes-Gn:XBJ1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ79270"
FT                   /db_xref="GOA:D3UY92"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR011973"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3UY92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ79270.1"
FT                   /translation="MSANASSQLAQRCIEAMYAKDACAQNMGMHIDHVDTGVAQVSMTI
FT                   KPDMLNGHQSCHGGILFSLADTAFAYACNSEGLAAVASGCSIDFIRPAFSGDRLTATAF
FT                   MQHQGKTTGLYDVRIINQDGKIVAFFRGHAHRLGHSILEDRQETPLQGEQS"
     atgtccgcta acgcttccag ccaactggct caacgctgca tagaagccat gtatgccaaa        60
     gatgcctgcg cccagaatat gggaatgcac atcgaccatg ttgatacagg ggtcgcccaa       120
     gtaagcatga ccattaaacc agacatgctc aacggccatc aaagctgtca tggtggcatc       180
     ctgttcagtc tggccgatac tgccttcgcc tatgcctgca acagcgaagg gctggcggcg       240
     gtggcatccg gttgtagcat tgattttatc cgcccggcct tcagcggtga ccgcctgaca       300
     gccaccgctt ttatgcagca tcagggaaaa accacgggct tgtatgacgt cagaattatc       360
     aatcaggacg gcaaaatcgt ggcctttttt cgtggtcatg cccatcgtct cggccattct       420
     attctggaag acaggcagga aacaccatta cagggagaac aatcatga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page